SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386073090|ref|YP_005987407.1| from Leptospira interrogans serovar Lai str. IPAV

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386073090|ref|YP_005987407.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.36e-33
Family Ribosomal protein L6 0.0000656
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.32e-21
Family Ribosomal protein L6 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386073090|ref|YP_005987407.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Leptospira interrogans serovar Lai str. IPAV]
Sequence
MSRIGKAEIKLPDKVEVKQENANIKVKGPLGELFTPIFEGISVKTENGIVKLERSNEDQK
VVALHGLTRALLMNCVKGVSQGWEKNLEITGVGYRAQKRGEDLVMSLGFSHEVVYKAPKG
IKIDVQEQLKIKVSGIDKQLVGQVAADIRSKRPPEPYKGKGIKYAEEFIKKKAGKTGKK
Download sequence
Identical sequences A0A098MPH6 A0A0E2B6G9 A0A0E2CLQ6 A0A0E2D634 A0A0F6HGH3 A0A0F6HZQ4 A0A0F6IFU9 A0A0M5L762 A0A163P2K7 A0A1N6TK74 A0A1V2ZLV7 A0A1X8WTC9 A0A2H1XD29 M3E8W9 M3HYX0 M5ZV59 M6G9D9 M6HRP0 M6KNT6 M6RE52 M6ZHD9 N1UVW3 Q72NH6 Q9XD21
gi|386073090|ref|YP_005987407.1| NP_710935.1.97817 WP_000086547.1.10054 WP_000086547.1.100607 WP_000086547.1.100943 WP_000086547.1.10099 WP_000086547.1.101113 WP_000086547.1.101360 WP_000086547.1.102083 WP_000086547.1.11367 WP_000086547.1.11416 WP_000086547.1.11890 WP_000086547.1.12132 WP_000086547.1.12257 WP_000086547.1.12296 WP_000086547.1.13846 WP_000086547.1.14057 WP_000086547.1.14181 WP_000086547.1.14552 WP_000086547.1.15012 WP_000086547.1.15739 WP_000086547.1.17129 WP_000086547.1.17260 WP_000086547.1.175 WP_000086547.1.1759 WP_000086547.1.17762 WP_000086547.1.18168 WP_000086547.1.18925 WP_000086547.1.18988 WP_000086547.1.19091 WP_000086547.1.19636 WP_000086547.1.19821 WP_000086547.1.19906 WP_000086547.1.20233 WP_000086547.1.2069 WP_000086547.1.20778 WP_000086547.1.2170 WP_000086547.1.22564 WP_000086547.1.22580 WP_000086547.1.23212 WP_000086547.1.23353 WP_000086547.1.23514 WP_000086547.1.2392 WP_000086547.1.24270 WP_000086547.1.24738 WP_000086547.1.250 WP_000086547.1.25259 WP_000086547.1.25470 WP_000086547.1.26235 WP_000086547.1.26477 WP_000086547.1.26822 WP_000086547.1.27867 WP_000086547.1.28 WP_000086547.1.28517 WP_000086547.1.2987 WP_000086547.1.30744 WP_000086547.1.30921 WP_000086547.1.30957 WP_000086547.1.31178 WP_000086547.1.3128 WP_000086547.1.3175 WP_000086547.1.31926 WP_000086547.1.32453 WP_000086547.1.32692 WP_000086547.1.32859 WP_000086547.1.3288 WP_000086547.1.33670 WP_000086547.1.339 WP_000086547.1.34232 WP_000086547.1.34457 WP_000086547.1.34735 WP_000086547.1.35515 WP_000086547.1.35633 WP_000086547.1.35956 WP_000086547.1.36128 WP_000086547.1.36297 WP_000086547.1.36581 WP_000086547.1.36759 WP_000086547.1.37254 WP_000086547.1.3754 WP_000086547.1.37594 WP_000086547.1.382 WP_000086547.1.38403 WP_000086547.1.39007 WP_000086547.1.39100 WP_000086547.1.39787 WP_000086547.1.39967 WP_000086547.1.40783 WP_000086547.1.41353 WP_000086547.1.41637 WP_000086547.1.42222 WP_000086547.1.42779 WP_000086547.1.4308 WP_000086547.1.43311 WP_000086547.1.43353 WP_000086547.1.43570 WP_000086547.1.43638 WP_000086547.1.44274 WP_000086547.1.45100 WP_000086547.1.45262 WP_000086547.1.45679 WP_000086547.1.4572 WP_000086547.1.46007 WP_000086547.1.46812 WP_000086547.1.46987 WP_000086547.1.46993 WP_000086547.1.47834 WP_000086547.1.48092 WP_000086547.1.48108 WP_000086547.1.48207 WP_000086547.1.48838 WP_000086547.1.49027 WP_000086547.1.49352 WP_000086547.1.50403 WP_000086547.1.50455 WP_000086547.1.50786 WP_000086547.1.50856 WP_000086547.1.50904 WP_000086547.1.51217 WP_000086547.1.51443 WP_000086547.1.51531 WP_000086547.1.5165 WP_000086547.1.51668 WP_000086547.1.51687 WP_000086547.1.51773 WP_000086547.1.52005 WP_000086547.1.52351 WP_000086547.1.53255 WP_000086547.1.53569 WP_000086547.1.5446 WP_000086547.1.54587 WP_000086547.1.55693 WP_000086547.1.55703 WP_000086547.1.55852 WP_000086547.1.56120 WP_000086547.1.56629 WP_000086547.1.5678 WP_000086547.1.58842 WP_000086547.1.59857 WP_000086547.1.60409 WP_000086547.1.60804 WP_000086547.1.6135 WP_000086547.1.61403 WP_000086547.1.61658 WP_000086547.1.62172 WP_000086547.1.63084 WP_000086547.1.63541 WP_000086547.1.63646 WP_000086547.1.64760 WP_000086547.1.64963 WP_000086547.1.65294 WP_000086547.1.65513 WP_000086547.1.65559 WP_000086547.1.65719 WP_000086547.1.6574 WP_000086547.1.668 WP_000086547.1.67052 WP_000086547.1.67243 WP_000086547.1.67344 WP_000086547.1.67411 WP_000086547.1.67421 WP_000086547.1.6761 WP_000086547.1.68135 WP_000086547.1.68426 WP_000086547.1.68799 WP_000086547.1.69136 WP_000086547.1.69218 WP_000086547.1.70155 WP_000086547.1.70516 WP_000086547.1.70913 WP_000086547.1.70921 WP_000086547.1.71080 WP_000086547.1.72166 WP_000086547.1.72187 WP_000086547.1.7280 WP_000086547.1.72830 WP_000086547.1.73036 WP_000086547.1.73107 WP_000086547.1.73302 WP_000086547.1.73583 WP_000086547.1.74258 WP_000086547.1.74515 WP_000086547.1.74558 WP_000086547.1.74792 WP_000086547.1.75054 WP_000086547.1.75316 WP_000086547.1.75377 WP_000086547.1.76404 WP_000086547.1.76740 WP_000086547.1.76970 WP_000086547.1.76971 WP_000086547.1.7707 WP_000086547.1.77178 WP_000086547.1.77242 WP_000086547.1.77874 WP_000086547.1.78069 WP_000086547.1.7821 WP_000086547.1.78364 WP_000086547.1.78551 WP_000086547.1.78739 WP_000086547.1.79237 WP_000086547.1.79939 WP_000086547.1.81113 WP_000086547.1.81443 WP_000086547.1.8167 WP_000086547.1.81803 WP_000086547.1.82080 WP_000086547.1.82375 WP_000086547.1.82393 WP_000086547.1.82978 WP_000086547.1.83052 WP_000086547.1.83201 WP_000086547.1.84222 WP_000086547.1.84376 WP_000086547.1.84406 WP_000086547.1.84450 WP_000086547.1.85034 WP_000086547.1.86863 WP_000086547.1.86894 WP_000086547.1.87123 WP_000086547.1.8721 WP_000086547.1.8748 WP_000086547.1.87797 WP_000086547.1.87860 WP_000086547.1.88006 WP_000086547.1.88844 WP_000086547.1.8916 WP_000086547.1.89725 WP_000086547.1.90188 WP_000086547.1.90537 WP_000086547.1.90631 WP_000086547.1.90803 WP_000086547.1.91009 WP_000086547.1.91013 WP_000086547.1.91017 WP_000086547.1.91046 WP_000086547.1.91324 WP_000086547.1.92480 WP_000086547.1.9249 WP_000086547.1.93413 WP_000086547.1.95586 WP_000086547.1.95836 WP_000086547.1.96306 WP_000086547.1.96462 WP_000086547.1.9683 WP_000086547.1.96841 WP_000086547.1.97198 WP_000086547.1.97216 WP_000086547.1.97385 WP_000086547.1.97703 WP_000086547.1.98154 WP_000086547.1.9886 gi|45658688|ref|YP_002774.1| gi|24213454|ref|NP_710935.1| 189518.LA0754 267671.LIC12858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]