SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386073483|ref|YP_005987800.1| from Leptospira interrogans serovar Lai str. IPAV

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386073483|ref|YP_005987800.1|
Domain Number 1 Region: 164-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.06e-62
Family Methylesterase CheB, C-terminal domain 0.00000727
Further Details:      
 
Domain Number 2 Region: 4-120
Classification Level Classification E-value
Superfamily CheY-like 3.27e-26
Family CheY-related 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386073483|ref|YP_005987800.1|
Sequence length 357
Comment chemotaxis-specific methylesterase CheB [Leptospira interrogans serovar Lai str. IPAV]
Sequence
MIPNPVRAVIIDDSLLVRNIISDQIQKDSKIHVVATGKTGMDCIDLAQKMNPDVIILDVE
MPVMDGLTALHELQKKKLGIPVIMLSVLTQNGAEATFKALEYGAIDFVPKPSSVFQFDPE
EIGNILKSKILAYFESKIQIPSQNLLKKAPAYSKVPAGSHLKKSPIQAICIGTSTGGPRA
LQEVFSRIPADISLPILVVQHMPAGFTKAFATRLNDHAKIKVKEAEDGEPIEPNTGYVAP
GDAHLSIQSKGGRKWIALNREAPVNGHRPSIEVLLDSAIEEYKSGIIGVIMTGMGKDGSA
AIVRVREIGGSTIAQDEQTSVIYGMNRQAVEMGGVEYIEPVTEIINRIQIILKERGI
Download sequence
Identical sequences A0A098MTD9 A0A0C5X0C5 A0A0E2CPR0 A0A0E2D1E8 A0A0F6HCB0 A0A0F6I466 A0A0F6I9N4 A0A0M4NIF8 A0A163RE28 A0A1B9FHD9 A0A1N6TBA4 A0A2H1XHZ7 M3E670 M5ZDV6 M6HJ79 N1UR65 P62641 Q8F6P9
gi|24213952|ref|NP_711433.1| gi|45658298|ref|YP_002384.1| 189518.LA1252 267671.LIC12455 NP_711433.1.97817 WP_000612786.1.10054 WP_000612786.1.100607 WP_000612786.1.100943 WP_000612786.1.10099 WP_000612786.1.101113 WP_000612786.1.101360 WP_000612786.1.102083 WP_000612786.1.11367 WP_000612786.1.11416 WP_000612786.1.11890 WP_000612786.1.12132 WP_000612786.1.12257 WP_000612786.1.12296 WP_000612786.1.13846 WP_000612786.1.14057 WP_000612786.1.14181 WP_000612786.1.14552 WP_000612786.1.15012 WP_000612786.1.1506 WP_000612786.1.15739 WP_000612786.1.16487 WP_000612786.1.17129 WP_000612786.1.17260 WP_000612786.1.175 WP_000612786.1.1759 WP_000612786.1.17762 WP_000612786.1.18168 WP_000612786.1.18925 WP_000612786.1.18988 WP_000612786.1.19091 WP_000612786.1.19636 WP_000612786.1.19906 WP_000612786.1.20233 WP_000612786.1.2069 WP_000612786.1.20778 WP_000612786.1.2170 WP_000612786.1.22580 WP_000612786.1.23212 WP_000612786.1.23353 WP_000612786.1.23514 WP_000612786.1.2392 WP_000612786.1.24270 WP_000612786.1.24738 WP_000612786.1.250 WP_000612786.1.25259 WP_000612786.1.25470 WP_000612786.1.25773 WP_000612786.1.26235 WP_000612786.1.26477 WP_000612786.1.26822 WP_000612786.1.27867 WP_000612786.1.28 WP_000612786.1.28517 WP_000612786.1.2987 WP_000612786.1.30744 WP_000612786.1.30921 WP_000612786.1.30957 WP_000612786.1.31178 WP_000612786.1.31321 WP_000612786.1.3175 WP_000612786.1.31926 WP_000612786.1.32453 WP_000612786.1.32692 WP_000612786.1.32859 WP_000612786.1.33670 WP_000612786.1.339 WP_000612786.1.34232 WP_000612786.1.34457 WP_000612786.1.34735 WP_000612786.1.35515 WP_000612786.1.35633 WP_000612786.1.35956 WP_000612786.1.36087 WP_000612786.1.36128 WP_000612786.1.36297 WP_000612786.1.36581 WP_000612786.1.36759 WP_000612786.1.37254 WP_000612786.1.3754 WP_000612786.1.37594 WP_000612786.1.382 WP_000612786.1.38403 WP_000612786.1.3874 WP_000612786.1.39007 WP_000612786.1.39100 WP_000612786.1.39787 WP_000612786.1.39967 WP_000612786.1.40783 WP_000612786.1.41353 WP_000612786.1.41637 WP_000612786.1.42222 WP_000612786.1.42779 WP_000612786.1.4308 WP_000612786.1.43311 WP_000612786.1.43353 WP_000612786.1.43570 WP_000612786.1.44326 WP_000612786.1.45100 WP_000612786.1.45262 WP_000612786.1.45679 WP_000612786.1.4572 WP_000612786.1.46007 WP_000612786.1.46812 WP_000612786.1.46987 WP_000612786.1.46993 WP_000612786.1.47686 WP_000612786.1.47834 WP_000612786.1.48092 WP_000612786.1.48207 WP_000612786.1.48838 WP_000612786.1.49027 WP_000612786.1.49352 WP_000612786.1.50403 WP_000612786.1.50455 WP_000612786.1.50786 WP_000612786.1.50856 WP_000612786.1.50904 WP_000612786.1.51217 WP_000612786.1.51443 WP_000612786.1.51531 WP_000612786.1.5165 WP_000612786.1.51687 WP_000612786.1.51773 WP_000612786.1.52005 WP_000612786.1.52351 WP_000612786.1.53255 WP_000612786.1.53346 WP_000612786.1.53569 WP_000612786.1.5368 WP_000612786.1.54587 WP_000612786.1.55693 WP_000612786.1.55852 WP_000612786.1.56120 WP_000612786.1.56629 WP_000612786.1.5678 WP_000612786.1.56812 WP_000612786.1.58511 WP_000612786.1.58842 WP_000612786.1.59857 WP_000612786.1.60409 WP_000612786.1.60804 WP_000612786.1.6135 WP_000612786.1.61403 WP_000612786.1.61658 WP_000612786.1.6171 WP_000612786.1.61777 WP_000612786.1.62172 WP_000612786.1.62196 WP_000612786.1.62202 WP_000612786.1.63084 WP_000612786.1.63541 WP_000612786.1.63646 WP_000612786.1.63688 WP_000612786.1.64760 WP_000612786.1.64963 WP_000612786.1.65294 WP_000612786.1.65513 WP_000612786.1.65719 WP_000612786.1.66305 WP_000612786.1.668 WP_000612786.1.67052 WP_000612786.1.67243 WP_000612786.1.67344 WP_000612786.1.67411 WP_000612786.1.67421 WP_000612786.1.6761 WP_000612786.1.68135 WP_000612786.1.68426 WP_000612786.1.68799 WP_000612786.1.69136 WP_000612786.1.69218 WP_000612786.1.70155 WP_000612786.1.70516 WP_000612786.1.70913 WP_000612786.1.70921 WP_000612786.1.71080 WP_000612786.1.71461 WP_000612786.1.72166 WP_000612786.1.72187 WP_000612786.1.7280 WP_000612786.1.72830 WP_000612786.1.73036 WP_000612786.1.73107 WP_000612786.1.73302 WP_000612786.1.73583 WP_000612786.1.74258 WP_000612786.1.74515 WP_000612786.1.74558 WP_000612786.1.74792 WP_000612786.1.75054 WP_000612786.1.75316 WP_000612786.1.75377 WP_000612786.1.76063 WP_000612786.1.76404 WP_000612786.1.76970 WP_000612786.1.76971 WP_000612786.1.7707 WP_000612786.1.77178 WP_000612786.1.77242 WP_000612786.1.77874 WP_000612786.1.78069 WP_000612786.1.7821 WP_000612786.1.78364 WP_000612786.1.78551 WP_000612786.1.78739 WP_000612786.1.79237 WP_000612786.1.79939 WP_000612786.1.81113 WP_000612786.1.81443 WP_000612786.1.8167 WP_000612786.1.81803 WP_000612786.1.82080 WP_000612786.1.82375 WP_000612786.1.82393 WP_000612786.1.82978 WP_000612786.1.83201 WP_000612786.1.84376 WP_000612786.1.84406 WP_000612786.1.84450 WP_000612786.1.85034 WP_000612786.1.86863 WP_000612786.1.86894 WP_000612786.1.87123 WP_000612786.1.8721 WP_000612786.1.8748 WP_000612786.1.87797 WP_000612786.1.87860 WP_000612786.1.87965 WP_000612786.1.88006 WP_000612786.1.88138 WP_000612786.1.88844 WP_000612786.1.8916 WP_000612786.1.89725 WP_000612786.1.90188 WP_000612786.1.90537 WP_000612786.1.90631 WP_000612786.1.90803 WP_000612786.1.91009 WP_000612786.1.91013 WP_000612786.1.91017 WP_000612786.1.91046 WP_000612786.1.91324 WP_000612786.1.92349 WP_000612786.1.92480 WP_000612786.1.9249 WP_000612786.1.93413 WP_000612786.1.95586 WP_000612786.1.95836 WP_000612786.1.96306 WP_000612786.1.96462 WP_000612786.1.9683 WP_000612786.1.96841 WP_000612786.1.97198 WP_000612786.1.97216 WP_000612786.1.97385 WP_000612786.1.97703 WP_000612786.1.98154 WP_000612786.1.9886 gi|386073483|ref|YP_005987800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]