SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386074207|ref|YP_005988524.1| from Leptospira interrogans serovar Lai str. IPAV

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386074207|ref|YP_005988524.1|
Domain Number 1 Region: 260-546
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.57e-58
Family DNA repair protein MutS, domain III 0.0000134
Further Details:      
 
Domain Number 2 Region: 555-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.92e-54
Family ABC transporter ATPase domain-like 0.0000012
Further Details:      
 
Domain Number 3 Region: 21-125
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.05e-37
Family DNA repair protein MutS, domain I 0.0000371
Further Details:      
 
Domain Number 4 Region: 127-272
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.27e-23
Family DNA repair protein MutS, domain II 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386074207|ref|YP_005988524.1|
Sequence length 848
Comment DNA mismatch repair protein mutS [Leptospira interrogans serovar Lai str. IPAV]
Sequence
MNLESTATSAEYWSDLADALNTPMMKQFLAIKKDFPDTILFFRMGDFYEMFLEDAKIASS
ILDIALTKRQNAVPMCGIPYHSKDNYISRLLNAGKKIAICEQSKPEEAGSKLMTRDVVRI
ITPGTVIEENLLSGFQNNYLAVLHLKKSLIYFAIADFSTGEVFYSSVSVTGLERLIAELE
KFKPSEICVPKSEHTFFQELEYFKNREFTVLKNQIETSEKDSFQVLSKYLNEYIRETYRD
NKLVLREPKILSSGKFLEMDRETIRNLELVENEKEKNNTLYSIFNFCNTAKGKRLLKQRI
LFPECDPVVLYSRWEKQDILLKTVLAPYITALKDFGDLERILTRFRGNHAYPRDFRSLLN
SISSGIKLKEELEKVSYPFLIPIEELKKISDFIQERLHPGDDLPVILGNGIFLKKGFSQK
LDQAREAGVKGKDWILDLETKEKKRTGLNTLKIRYNKIVGYFIEISRAQAEQAPKDYLKK
QTLVGSERFTMPKLEEIERTILEADEIIQEIERTEFNRMVEEVLKFSSSLLSFSEEIGDL
DFQISLLTAKDKFGWIRPKLSEDRSLDLSDSRHPVVEATLPPGQEFIPNSVYLDTQDKAI
AVLTGPNMAGKSTFMRQIALNQILFQIGAFVPAKSAKLPIVDKLFTRIGAGDNLTAGEST
FFVEMKETANILNHYTEDSLILFDEVGRGTSTYDGMSIAWSILEYLSSLSVRPKTIFATH
YHELTELSRLGGIFNLYLETLEKEDRVLFLRKVKVGKAKKSFGIYVAKIAGVPEPIVKRA
AELLTDLESKKKEIKIQEAQPTLFTEPETKNFNSQTEESILKLKLEEMTPIEALKTLEDF
QKKLRKQK
Download sequence
Identical sequences A0A0C5X442 A0A0E2CQ03 A0A0E2CZ88 A0A0F6H822 A0A0F6I0H2 A0A1V2ZSK7 M3I644 Q8F496
gi|24214846|ref|NP_712327.1| gi|386074207|ref|YP_005988524.1| NP_712327.1.97817 WP_001047648.1.100607 WP_001047648.1.10099 WP_001047648.1.11890 WP_001047648.1.14181 WP_001047648.1.15012 WP_001047648.1.18988 WP_001047648.1.19821 WP_001047648.1.19906 WP_001047648.1.2069 WP_001047648.1.20778 WP_001047648.1.2170 WP_001047648.1.22580 WP_001047648.1.23514 WP_001047648.1.24270 WP_001047648.1.24738 WP_001047648.1.25470 WP_001047648.1.26477 WP_001047648.1.2987 WP_001047648.1.30744 WP_001047648.1.31178 WP_001047648.1.3128 WP_001047648.1.31321 WP_001047648.1.3175 WP_001047648.1.35956 WP_001047648.1.37254 WP_001047648.1.39100 WP_001047648.1.42779 WP_001047648.1.43570 WP_001047648.1.44326 WP_001047648.1.46007 WP_001047648.1.46993 WP_001047648.1.49027 WP_001047648.1.51443 WP_001047648.1.5165 WP_001047648.1.51687 WP_001047648.1.53569 WP_001047648.1.5368 WP_001047648.1.5446 WP_001047648.1.5678 WP_001047648.1.59857 WP_001047648.1.60804 WP_001047648.1.62196 WP_001047648.1.65719 WP_001047648.1.6574 WP_001047648.1.66305 WP_001047648.1.67243 WP_001047648.1.68993 WP_001047648.1.69136 WP_001047648.1.69218 WP_001047648.1.70155 WP_001047648.1.70516 WP_001047648.1.70913 WP_001047648.1.73107 WP_001047648.1.74792 WP_001047648.1.7707 WP_001047648.1.77178 WP_001047648.1.77874 WP_001047648.1.78364 WP_001047648.1.78739 WP_001047648.1.79939 WP_001047648.1.81113 WP_001047648.1.82080 WP_001047648.1.82375 WP_001047648.1.82978 WP_001047648.1.83052 WP_001047648.1.84406 WP_001047648.1.85034 WP_001047648.1.87860 WP_001047648.1.88006 WP_001047648.1.96306 WP_001047648.1.96841 WP_001047648.1.97385 WP_001047648.1.98154 189518.LA2146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]