SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386074450|ref|YP_005988767.1| from Leptospira interrogans serovar Lai str. IPAV

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386074450|ref|YP_005988767.1|
Domain Number 1 Region: 161-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-69
Family Methylesterase CheB, C-terminal domain 0.0000005
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily CheY-like 5.69e-26
Family CheY-related 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386074450|ref|YP_005988767.1|
Sequence length 347
Comment chemotaxis-specific methylesterase CheB [Leptospira interrogans serovar Lai str. IPAV]
Sequence
MIQVFIVDDSAVVRQVLTQILNKDPEIEIIGFASDPIFASEKLSSVWPDVFILDIEMPRM
DGISFLKKIMSEKPTPVIICSSLAEKESETAVLAMKLGAVDIIEKPKVGLKNFLEESEIL
FIDSVRAASNARVKTHSFQNDDSKFLENHKQPKTDFSKIDTTDKLIAIGTSTGGTQALEF
ILTQLNIHCPGIVIVQHMPEKFTEAFANRLNQVCKIQVKEAKDGDRVQLGSAYIAPGNKH
MEIYLSGAQFHIRVLDGPLVNRHRPSVDTLFHSVAKAAGKNAKGIIMTGMGNDGANGLLK
MKQSGAHTIAQDEASCVVFGMPKEAILKGAVNTILPLSKIVGEVQYF
Download sequence
Identical sequences A0A0C5XCR6 A0A0F6H785 A0A0M4MUL4 A0A1N6UMC7 A0A1X8WJK3 M3IHJ2 M6ZF98 P62643 Q8F3H4
gi|24215129|ref|NP_712610.1| gi|386074450|ref|YP_005988767.1| 189518.LA2429 267671.LIC11520 gi|45657393|ref|YP_001479.1| NP_712610.1.97817 WP_000616854.1.10054 WP_000616854.1.100943 WP_000616854.1.101113 WP_000616854.1.101360 WP_000616854.1.11367 WP_000616854.1.11416 WP_000616854.1.11890 WP_000616854.1.12257 WP_000616854.1.12296 WP_000616854.1.13846 WP_000616854.1.14057 WP_000616854.1.14552 WP_000616854.1.15739 WP_000616854.1.17129 WP_000616854.1.17260 WP_000616854.1.175 WP_000616854.1.1759 WP_000616854.1.17762 WP_000616854.1.18168 WP_000616854.1.18925 WP_000616854.1.18988 WP_000616854.1.19091 WP_000616854.1.19636 WP_000616854.1.19821 WP_000616854.1.20233 WP_000616854.1.2069 WP_000616854.1.22564 WP_000616854.1.22580 WP_000616854.1.23212 WP_000616854.1.23353 WP_000616854.1.2392 WP_000616854.1.24270 WP_000616854.1.250 WP_000616854.1.25470 WP_000616854.1.26822 WP_000616854.1.28 WP_000616854.1.28517 WP_000616854.1.2987 WP_000616854.1.30921 WP_000616854.1.30957 WP_000616854.1.31178 WP_000616854.1.3128 WP_000616854.1.31321 WP_000616854.1.3175 WP_000616854.1.32453 WP_000616854.1.32692 WP_000616854.1.32859 WP_000616854.1.3288 WP_000616854.1.33670 WP_000616854.1.339 WP_000616854.1.34232 WP_000616854.1.34457 WP_000616854.1.35633 WP_000616854.1.36128 WP_000616854.1.3754 WP_000616854.1.37594 WP_000616854.1.38403 WP_000616854.1.39007 WP_000616854.1.39100 WP_000616854.1.39787 WP_000616854.1.39967 WP_000616854.1.40783 WP_000616854.1.41353 WP_000616854.1.41637 WP_000616854.1.42222 WP_000616854.1.43311 WP_000616854.1.43353 WP_000616854.1.44274 WP_000616854.1.44326 WP_000616854.1.4572 WP_000616854.1.46812 WP_000616854.1.46987 WP_000616854.1.48092 WP_000616854.1.48108 WP_000616854.1.48207 WP_000616854.1.48838 WP_000616854.1.49352 WP_000616854.1.50455 WP_000616854.1.50786 WP_000616854.1.50904 WP_000616854.1.51217 WP_000616854.1.5165 WP_000616854.1.51773 WP_000616854.1.52005 WP_000616854.1.52351 WP_000616854.1.53255 WP_000616854.1.53569 WP_000616854.1.5368 WP_000616854.1.55693 WP_000616854.1.55703 WP_000616854.1.56120 WP_000616854.1.6135 WP_000616854.1.61658 WP_000616854.1.62196 WP_000616854.1.63084 WP_000616854.1.63541 WP_000616854.1.63646 WP_000616854.1.64760 WP_000616854.1.65294 WP_000616854.1.65513 WP_000616854.1.6574 WP_000616854.1.66305 WP_000616854.1.668 WP_000616854.1.67344 WP_000616854.1.6761 WP_000616854.1.68426 WP_000616854.1.68993 WP_000616854.1.70155 WP_000616854.1.72166 WP_000616854.1.72187 WP_000616854.1.7280 WP_000616854.1.72830 WP_000616854.1.73036 WP_000616854.1.73107 WP_000616854.1.73302 WP_000616854.1.73583 WP_000616854.1.74258 WP_000616854.1.74515 WP_000616854.1.74558 WP_000616854.1.74792 WP_000616854.1.75054 WP_000616854.1.75316 WP_000616854.1.75377 WP_000616854.1.76404 WP_000616854.1.76970 WP_000616854.1.76971 WP_000616854.1.7707 WP_000616854.1.77242 WP_000616854.1.77874 WP_000616854.1.78069 WP_000616854.1.7821 WP_000616854.1.78364 WP_000616854.1.78551 WP_000616854.1.79237 WP_000616854.1.79939 WP_000616854.1.81443 WP_000616854.1.81803 WP_000616854.1.82080 WP_000616854.1.82375 WP_000616854.1.82393 WP_000616854.1.82978 WP_000616854.1.83052 WP_000616854.1.83201 WP_000616854.1.84222 WP_000616854.1.84406 WP_000616854.1.84450 WP_000616854.1.85034 WP_000616854.1.86863 WP_000616854.1.87123 WP_000616854.1.8721 WP_000616854.1.8748 WP_000616854.1.87797 WP_000616854.1.88006 WP_000616854.1.88844 WP_000616854.1.89725 WP_000616854.1.90537 WP_000616854.1.90803 WP_000616854.1.91009 WP_000616854.1.91013 WP_000616854.1.91017 WP_000616854.1.91046 WP_000616854.1.91324 WP_000616854.1.92480 WP_000616854.1.9249 WP_000616854.1.93413 WP_000616854.1.95586 WP_000616854.1.95836 WP_000616854.1.9683 WP_000616854.1.96841 WP_000616854.1.97198 WP_000616854.1.97216 WP_000616854.1.97385 WP_000616854.1.97703 WP_000616854.1.98154 WP_000616854.1.9886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]