SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386072626|ref|YP_005986943.1| from Leptospira interrogans serovar Lai str. IPAV

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386072626|ref|YP_005986943.1|
Domain Number 1 Region: 76-204
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.98e-31
Family Ferredoxin domains from multidomain proteins 0.00019
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.52e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0093
Further Details:      
 
Domain Number 3 Region: 213-317
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.83e-17
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0023
Further Details:      
 
Domain Number 4 Region: 354-470
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.000000000877
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386072626|ref|YP_005986943.1|
Sequence length 482
Comment NADH dehydrogenase (ubiquinone) chain G [Leptospira interrogans serovar Lai str. IPAV]
Sequence
MVKIKIDGIEYEVDEKKNLISAAKDVGVDIPFFCYHPKLSIVGMCRMCLIEIEGVPRLQA
ACNTKVTEGLSIFTKNDRIKEAREGTMEFLLANHPLDCPVCDKAGECQLQDNAFKEGKGN
SRFTLEKRNVPQEEVGSNLIINHNRCIVCYRCVRFEEEIVGESNLGLFERGYHSIIGLAK
NEPIQHNFQGALADLCPTGALLNNKTLFKSRVWWYKNGESICHGCSTGCNVTTNVRDNKM
YRYMPRIDEEKDMYFLCDHGRFDIDWLNENRLFAYYQNGNVSESTVVLPAIAEKVRQSKR
IAILGGAKESNENLKTILQSVESFEKSVIVEARVEEVQYKAPEQKDFLMTTDFRPNTRGA
VDSGFISSQEINAICKSIELGEIDLVFVIHENIKKFLHSIPSNVTLVLLNTNLTQEISEA
TYGIPIQTFAEQAGSFTNKNGLNQSFQKVMEPPKGLLNSGSVFRRIAELVKTSPKEAEVG
NR
Download sequence
Identical sequences A0A0F6I282 A0A0M5L6U4 A0A1V2ZN66 M6GWS6 M6H8I2 M6KHA2 M6ZYC3 N1UNE9 Q8F9N1
189518.LA0160 gi|386072626|ref|YP_005986943.1| NP_710341.1.97817 WP_000238899.1.100607 WP_000238899.1.11890 WP_000238899.1.18925 WP_000238899.1.19821 WP_000238899.1.2069 WP_000238899.1.22580 WP_000238899.1.25470 WP_000238899.1.26477 WP_000238899.1.26822 WP_000238899.1.2987 WP_000238899.1.30744 WP_000238899.1.31178 WP_000238899.1.3128 WP_000238899.1.34232 WP_000238899.1.35956 WP_000238899.1.37254 WP_000238899.1.3874 WP_000238899.1.39100 WP_000238899.1.46007 WP_000238899.1.48838 WP_000238899.1.5165 WP_000238899.1.51687 WP_000238899.1.51773 WP_000238899.1.5446 WP_000238899.1.5678 WP_000238899.1.65559 WP_000238899.1.65719 WP_000238899.1.69218 WP_000238899.1.70155 WP_000238899.1.70913 WP_000238899.1.76740 WP_000238899.1.78364 WP_000238899.1.82080 WP_000238899.1.82375 WP_000238899.1.83052 WP_000238899.1.84406 WP_000238899.1.85034 WP_000238899.1.88006 WP_000238899.1.93413 WP_000238899.1.96841 WP_000238899.1.98154 gi|24212860|ref|NP_710341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]