SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC19736 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC19736
Domain Number 1 Region: 7-155
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.12e-17
Family Histidine biosynthesis enzymes 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC19736
Sequence length 176
Comment pep:novel supercontig:GCA_000297895.1:scaffold42784:134049:147068:-1 gene:CGI_10007740 transcript:EKC19736 description:""
Sequence
MARDLDYIRAEGFVFSHVADEGWMDGCAGQLLRYRNYIGANNIQIFTDIKKKHSAHAVTS
DVSLVEMAKAAEFFGSDGVIITGTATGEQTNPEHVQDVISNVSVPVLVGSGVNSDNVTDY
KNASAVIVGSHFKRNQDWRQRINIPRLYNFMVNIFSDEIDFDKVLETDSDSDLDVR
Download sequence
Identical sequences K1QDZ8
EKC19736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]