SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC25210 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC25210
Domain Number 1 Region: 9-187
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.41e-51
Family D-ribulose-5-phosphate 3-epimerase 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC25210
Sequence length 194
Comment pep:novel supercontig:GCA_000297895.1:scaffold1722:325966:328726:1 gene:CGI_10014890 transcript:EKC25210 description:"Ribulose-phosphate 3-epimerase "
Sequence
MAAPCGGKKCRIGPSILNSDLSELASECQRMMDSGADYLHLDVMDGQFVPNLTFGHPVVK
CLRPKLPGVFFDMHMMVQKPEQVGVGIKPKTAVDVLVPLVDLVDMVLIMTVEPGFGGQKF
MADMMPKISFLREKYTDLEIEVDGGVSPSTIQHCADAGATMIVSGSAVVNSENPKETITY
MRDIVNQAIQKTPA
Download sequence
Identical sequences K1Q8L1
EKC25210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]