SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC35053 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC35053
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 8.63e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0001
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000445
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC35053
Sequence length 251
Comment pep:novel supercontig:GCA_000297895.1:scaffold580:251944:258646:1 gene:CGI_10020494 transcript:EKC35053 description:"Transcription initiation factor IIA subunit 1 "
Sequence
MANANPVPRLYKTVVEDVISNVREAFLDEGVDEQVLQELKQLWENKLTQSRALDSGPEPS
ESVMIPSTIQYIPQPVQNAPSKQQFIGASGVVTQNMPVPVQIASQDISQPAATAHMALPQ
GVLQQQLQALASQGLTLQPTGNGQFIIQALPQQGAHGQIGAPQLQQVTISQASIPTMIQQ
PQGQQQEPLNSDDDVSDEDPSDLFDTDNVVVCQYDKINRNKNKWKFHLKDGIMNLNGKDF
VFQKATGDAEW
Download sequence
Identical sequences K1QMJ8
EKC35053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]