SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC37744 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC37744
Domain Number 1 Region: 306-420
Classification Level Classification E-value
Superfamily Plus3-like 1.31e-37
Family Plus3 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC37744
Sequence length 673
Comment pep:novel supercontig:GCA_000297895.1:scaffold386:300882:313692:1 gene:CGI_10012696 transcript:EKC37744 description:"RNA polymerase-associated protein RTF1-like protein "
Sequence
MSKRKKTTALIDSDSDDSESGSNLDEDFKTLAKRNRPNTETKSASKPKTDSESETSESDD
DWNFGKKGSKKKKPKSSSKKAKRKAAVSSDESGAESDKHVSEPEEGEVSSSEDGGSSGSE
EEFHDGYDENLIGDADDKKRLEQMTEKEREQELFNRIERRQALKMRFEIEKKLKQQKKKE
QKKKEKGMVPTAQELKDLKSASQRSMERRKNMEEKKDNKKFSALTDLMKKREEKKKIAEE
QIKKQEEKQDQKKKLLKTSDIYSDDDDDEEEDPKSEPEKEREEDSGSESESSSTSRSSAR
SDSEGEEWCHMPFFKKTVCGCYVRIGIGNHEGRAVYRIAEIIDTVETAKIYQLGTTRTNK
GLKLKHGHSERVYRLEFVSNQDFTDSEFFKWREAMTLGDLSLPTVQDIDKKARSIQDALN
YKFKENDIEEIVAEKQKFKKNPHNYAIKKTFLLKQKEVADLEGDTAAQYKISQELEELEE
RANELDRRRTNNISSISYINQRNRLRNQILAEEASKKEFLEMKNAVADPFTRRSCRPTLV
TKARNPVISHSARDPEMEAKAQERLAEKRKLDEATRRKSLEEMGNIDQKMESDQNLYPNL
LSSTSLDKSDKGDKRRSSEDLFAVHDFNIEIDLEMPASNPAMAASSRGLQPIKEAAPKRS
LNLAEYKKMKGLI
Download sequence
Identical sequences K1R2H8
EKC37744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]