SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC43069 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC43069
Domain Number 1 Region: 2006-2135
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-34
Family Single strand DNA-binding domain, SSB 0.0000171
Further Details:      
 
Domain Number 2 Region: 2166-2297
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.75e-23
Family BRCA2 tower domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1887-2007
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.92e-23
Family BRCA2 helical domain 0.00032
Further Details:      
 
Domain Number 4 Region: 2137-2166,2300-2379
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-22
Family Single strand DNA-binding domain, SSB 0.0022
Further Details:      
 
Domain Number 5 Region: 2395-2509
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000591
Family Single strand DNA-binding domain, SSB 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC43069
Sequence length 2601
Comment pep:novel supercontig:GCA_000297895.1:scaffold11:133200:151876:-1 gene:CGI_10015527 transcript:EKC43069 description:"Breast cancer type 2 susceptibility-like protein "
Sequence
MEAAVGPSSEDWFQVATTQKLQAKQREKEERSLFMSPVSQCSSQLTPDILKFHRGGTYES
SPEISTFERLLSSQSSTSSPHSRWLHPSLGSSPQDGGRDQNLASEEAIIRSLGISADDSG
ISWTSSLATPSHPLSPTGSGVKQDVNEDQLPEKRKQKRVPRALFSPGVVRNPDELCHSLN
KSDIEIKVEPDEDTVKEGASKEIHVLDISVKSEVETDSMQLFSQELITEEPSLENDVVYL
GEKSLSTKKDNCASADETTAAAIKQEVIDETLSDFFDPPSKSVGRRRCAPSKGRKRKSLG
DSPLGFDFPFKREAKALVSSSPSLSPVAGARRVLKAAKEKFNTPVERNKPPRSILSNEKC
RGSKSGTRKRVTFSNSDDFFKGIDPGKEEGGNSNKQLKKTEDVDINVSAQIVESLKSRDF
DSCDQTKVQSVDVTVEDSEDLFSQVSPSSLNEMCSIDNEDLFAKDINSSSSKKNDDHGKI
LNSVDAVEPMGTNGNNKNTAVHNDTQKQHSSDEVPSKAEISPIVPKISGLRSKGRKFLYP
TTNQITKSCPKVVYGFKEVESPFHNQHTISESPTLEKNDEEPTAGQGIDNKSRETKSPKV
SSTTGFQRFSKLEPADNQREGQNPQHIKEESEVQPSTSMCGSSSKTFGGFSTAGGRKFVM
DKDALQKARSLLEKDYDNDLDNGVKKLFEQGEKAVENVDHRLDPISLPSTGSKECSSESI
MDGISGKDGCSFQGFQTARGKKVECSESSLKKAQRMILEEGATNETERKECTIGSKADWT
SSSSAGFQGFQTASGKKVECSESSLEKAQRMITEEGDTKKISNTETEWDDIESVMPSGDK
KSAAKGQEIGFSSVKEFINPGLKSSKYTALSSGSKSTDFQTKGKNIFSDIFEEFQDCGGN
IDADSIPGFKTAGGKGFNSSSSCLKNTIPTNNKKGSKEPNEESVDSVVEEDIIKSMFSGI
KGKVGNNSNTKPVGPSTFTRPVNTAQQMKSASIAARFPPGSNIPKGFRPFKPPKIAPKAK
PHIPTASDVVSKTTVNKSESVQEIQPHSNEGSRDEEKNVNENFCNKENDKMDDSADLSNL
FLNDMFEEEMEISQKLTPEPVANSGKIIKEISEESIERVKENVCCTSTTEKAEETTEKSL
NGGPSAKMPAEMVDVLQHKFDGFQTASGKAVSIDEESLKKAKELWDNQTTGNDDKDTYPE
ISDSEKEDNIHTSHVEEKMKEKPVQYGGFQTASGKHVTVSGKAMVEGKKLWKNSLKEDGH
PSISPLQSTKDNVQLPENENKKEKVSFSGFQTASGKTVKVDDKSLTEARKLWSSSGVEER
VTPTHTVLENLCQPDNFSQNNVKEKNELSSTYDEKTLQDSKEKPKNQIVPQLSSSSDMKS
NVSSLSSMGEKKMVNYINIQSGCPLAFQSPFMSASGKKIQVSEEALNHVKLETLKTEEGK
ENEKPAFQTDETKPVRNISASMSCPFFSASGKQISVSASALESTKSFFDDNEKDFSSLTT
DSKKFSPFQSASGKSVSVSKKSLEIARAILEEDHEMKTLHTAATTSLPNETHSKEKSFSP
FESASGKKVLVSQKSLEMARAKLEDNQGPEKQTSTPKISKVDYMEGDILPFQSASGKSVS
VSKKSLEKARARLMENFEADVDTLPTSSADTPSTSSRQETDVVFPAHSQKRKLDEIKTPK
KQKTREVEDANEYENLILPDDFFDEMETPNKKIKMENGTASKTIPGHVGNDRQNFTALST
VPEGYTKDRQNFYANPLKCQSARDSGSSHKALVKQEEAKKQNTPSAATASGSSFRTPYKA
GSTSTESQSQPNSMVKSVQPVFVPKSKQQAHPASSLDVKSGSKTVSKNLGPAVSSSLSTS
PQNGNSKQDMTQKTTKSDKEKEEYKKALETGRGKQEEMVKSKSSCSVKPSAGRLFQLKTS
GTRCKLREVIFGQQQNKTDVYVGDGALLVPDDQGYTGVKELYKAFLTIDSVDPSLISEAW
FCNHYRWIVWKLASYEVASPDKFGSRSALRKIMERDDTSSKRLVLCVSSVQRAESTNPAT
PSSKQTVLDPEVTVELSDGWYCIPAKLDVPLLDLINRRRIQTGHKLCTTGAELVGSQDPC
TPLEAPASLQLKINANSTRPVPWDTVLGFQPDPRPLCVPLSDLHGEGGMVGCVDVVLGRK
YPLMYMEKLPDGGSVFRTAQAEEKFSQLYQKQQQDAMESLYRKLEKDFDKEDYEESRAVK
RQWKESEIEELQSGQEVWEALRTAKRPDIVEGYLSDSQMRSLMDYKQQLHQEKLQRLQNE
FQKSWSDEQGNSKARNVVPLLKLRVMGLSKKDVDSGMSTVISVWRPGQEVLDLKEGQRYR
VFSLSASHSRARYSPNSVQLTANRQTKFLPVRVDENLLDLVYEPREVLCACDLKRRQPMF
GEVDIVCLIVNIEVTEAGESSRNQEIVYGMDKNGDILGIKFWGGLKAFGLNATLTVGTVV
CGSNLQDKFPQRSTILPLVEASMEFSVFTKTPQGALQKKAHQVLTERIKTAGEKTLVERG
QQLVAELLEKRRKMTLGHTPTKTVCSEQGEENASPVPPSSAQKAKIAQLMSYGSPSPLSP
IPTKVTPAAKKNFKVPKPAHV
Download sequence
Identical sequences K1RH48
EKC43069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]