SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC17462 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC17462
Domain Number 1 Region: 7-379
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-50
Family L-arabinose binding protein-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC17462
Sequence length 388
Comment pep:novel supercontig:GCA_000297895.1:C31694:3285:9162:1 gene:CGI_10000779 transcript:EKC17462 description:"Glutamate receptor, ionotropic kainate 1 "
Sequence
MSAIVYFFLDGFFEPEHKSAELAFKWTMQKINLHNDILSQVLVAYIVKEVPPDDSFDVSK
KVCREIAAGCKVIFGPGTRVSSSHVQSMCKFLAIPHIQAHWDPRDVITDTKDPDKDHFSL
NLYPYYLSLSTAFRNLIDYWKWTQFTVIYEDNDGLIRLQEVLKVSNLPETKVTVRKINDN
PESYISLFKDLKERGEYRIIIDCHVSRVGIIMEKALQVNAVSEYFHYLFTTLDLGLVELE
QFKHAGANITGMRLVDPERPLVSAVMGEWKYEMFSSSSRTSPLIDQTGIPTETALMYDAV
YLFARGLHGVQNAKNMNFRQSIMCNSSTSWEDGISLLNYMKTMDFEGLTGRIHFGKYGER
SDFTLDITKLDKPGLRKVQIHNDHVHLH
Download sequence
Identical sequences K1P0Y9
EKC17462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]