SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC17512 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC17512
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000165
Family L-arabinose binding protein-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC17512
Sequence length 123
Comment pep:novel supercontig:GCA_000297895.1:C30770:7458:8025:-1 gene:CGI_10000668 transcript:EKC17512 description:"Guanylate cyclase 32E "
Sequence
MDGVALLASHWNTPVFGWVSQDLAFQDKTMYSTLVRFLGPLNRFPNVLFHLQSLFKWSQF
SVVHDIRDPYRAVSEALGEYKTYGNKDMDWYSIVNTFKVSNDMDDKQIEEIFRQIQKFSR
SKF
Download sequence
Identical sequences K1P117
EKC17512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]