SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC19011 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC19011
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000871
Family L-arabinose binding protein-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC19011
Sequence length 103
Comment pep:novel supercontig:GCA_000297895.1:scaffold43366:166859:167170:-1 gene:CGI_10009990 transcript:EKC19011 description:""
Sequence
MLLTTFCSVLLVATAIWAKRKNITIGGIVADKNALPFALHRTGPAIERGIEKLRKIVADE
ADVTFILNVTTEFCVADMVGAIAAEMYYKHQVSAFIGPGMCYV
Download sequence
Identical sequences K1QC07
EKC19011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]