SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC21876 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC21876
Domain Number 1 Region: 61-150
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.48e-29
Family Calponin-homology domain, CH-domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 272-331
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.72e-20
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 
Domain Number 3 Region: 149-207
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4e-17
Family Calponin-homology domain, CH-domain 0.000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC21876
Sequence length 345
Comment pep:novel supercontig:GCA_000297895.1:scaffold39088:1454:13727:-1 gene:CGI_10003169 transcript:EKC21876 description:"Microtubule-associated protein RP/EB family member 3 "
Sequence
MSYYHSGIDPIARYKEKEKQIKQRQYERSNRAVHLWRKARFCVLKEQDLRERRDGQTDRS
MAVNVYSTNNQADNLSRHDILAWVNDSIHTNYGKIEELCSGAAYCQFMDMLFPGSIPIKK
VKFSTKLEHEFIQNYKLLQNSFKKTSVDKNYKILQSSFGKLGVDKVIPVERLVKGRFQDN
FEFVQWFKRFFDANYNGDGEYDPVMARGGETVGNVGKPAVMKSPAAAKTGISRGTTKAPT
RTTTKSPSAISKPVANVKATVNSGGGDNGAKIAELTQQINELRLTVEGLEKERDFYFGKL
RDIEVTCQENEDNEVIKNVMDILYATEDGFAPPEEDGNVEEEEEY
Download sequence
Identical sequences K1QJL6
EKC21876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]