SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC22241 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC22241
Domain Number 1 Region: 615-686
Classification Level Classification E-value
Superfamily EF-hand 0.00000301
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 2 Region: 506-598
Classification Level Classification E-value
Superfamily PKD domain 0.0000255
Family PKD domain 0.018
Further Details:      
 
Weak hits

Sequence:  EKC22241
Domain Number - Region: 117-292
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.046
Family BAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC22241
Sequence length 788
Comment pep:novel supercontig:GCA_000297895.1:scaffold38030:24625:38332:-1 gene:CGI_10002592 transcript:EKC22241 description:""
Sequence
MKKGSNGHIQREELMMTLLDDSSETDELQLPPLKGKKQVRRKRNPYSSPSSSHGGICNCW
QFMKMLIILLLVCSVTVMGFITVWLSNQVKDLQQQLNEVKGSSLQTSVDELKQQIQSSIK
KDLVNVTQSPKEMADVKLRLSSLTSKVNDQSSALEAVSKSQPGSQVIVNQVNTLSKQVPI
ISNTIGDLGVDVKAMKLEVEKLKEKVEKELADLKKQQTPEMGSGGRESGGRESGHVDLDT
EKLENLSNMIQLVNNSLWSELPKIQSKLSSHEVYLSALQNITANLQTQFKALNSDHSSIL
KDHKGMDQDSGEGTAQTKLLIHQVIEDMGLANQTSPSESLDNLSVKIDSITSTVGTLRDQ
FKLMKDSQGMAGSADTGSIQTSLQALNRSIEVLKEDFHTLMGKVGKQSNTITELSKTVEV
LKHFSASLDKDHREMVNGQTTSAAPPTPTIRTPVVKSDLDLLPASPTASSVPTSTAKAPD
VKQDKDQVPTTKLPPHNTEPIVKNENKPPVAKTEGHITITLPIQELYLNGTGSTDDEDVV
LYHWEQKDGPSVLNMFQEDEAIARATGDFIPGQYIFELQVWDAESLTSKKTLTVDVQDKP
SEKSVRSTLDVSQPTSPPEVHKFITMKLVNSYEDLETGVRRWDKDGDGLIDVQDLPDYMP
DPPSQQQLEMFDFNHDGLYNIDELAVALGFQPWPKDHGALSSRRVGYALFHIWVDLVTLS
HMLLIIDGVVVAHMPGPDPPIQDPSILFSGHLFSQWHFASILYVTVSSRGLIAPFIILPS
SSTGRLKY
Download sequence
Identical sequences K1QKI0
EKC22241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]