SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC23146 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC23146
Domain Number 1 Region: 353-468,576-714
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.13e-57
Family Phosphate binding protein-like 0.00000243
Further Details:      
 
Domain Number 2 Region: 67-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000848
Family L-arabinose binding protein-like 0.028
Further Details:      
 
Domain Number 3 Region: 459-570
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000772
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC23146
Sequence length 777
Comment pep:novel supercontig:GCA_000297895.1:scaffold1901:187797:197250:1 gene:CGI_10015550 transcript:EKC23146 description:"Glutamate receptor 4 "
Sequence
MEHRIFFLLLGVIVTFCDVTSEETFRLKIGIVGTWTPVFDELLRTIGLSHPWRIYNITTA
KPKSQYDKMLKVKDFLTDNQIDVILGPYDDATGIVADKLRVPYICTTGSKRNLNYTFQIL
PPLEDFSVYIMEQLLTNHDMMVKSWHVKGGSDIKAVEKQVRDHLVRMRQAFVQKSIIFCS
KEHTEIILDQARSLAMLSQPSEWFFYDPGDQLVPVFKNFPDVFVNFTVFGLMEFDSRNEI
ASVDDSRRLNISLAADSLRLLNATLPKAVEVQRNEAAFTIAEELRKIRIPGYTGDIEFGP
NGRRYNYTIKLSEIEGLDSLQVGVWRSHSNSLEDKIHFEEVKRLNRNYSFPLKGRTVSVV
MILEKPFTMQKRDYMQRLGNDRFEGFAVDLITEVAKMLDFNFEIYLVHDGKFGTKKENGE
WNGMIGELLAGNATMLVAPLSINSQREEAVDFTKPFMTRYISVLMRVPKSEQSYFEFLNP
LHHNVWYCTFGAFMMVSVILYFLERFGIRQNKDYPTISFRESFWFVFGSLLQGNTDSSPS
TLPGRILTSAWWFFALILISSYTANLAAFLTVKKINTPIKSVTDLASQTKIKYGTVKSSG
IMFFFKNTNIEHFAKMWAQMSEVDPSSMVDSTDEGFKKVKDGNYAFFWDTTVNKYKTIED
CQFMEIGPHFDPKGFGIGVPPGAIYREDLSMAILKLSDTGMLHQLENKWWPSRSCPDLSK
PSADETSELSIDSVAGVFFILLGGIALAGIVCGFEHFAKVVKKAAKTEKRGKTLFPA
Download sequence
Identical sequences K1QNL6
EKC23146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]