SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC23979 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC23979
Domain Number 1 Region: 280-585
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.14e-25
Family Lipovitellin-phosvitin complex, superhelical domain 0.002
Further Details:      
 
Domain Number 2 Region: 73-261
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.08e-22
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0011
Further Details:      
 
Domain Number 3 Region: 823-875
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000000001
Family Universal stress protein-like 0.0043
Further Details:      
 
Domain Number 4 Region: 885-948
Classification Level Classification E-value
Superfamily NHL repeat 0.0000392
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC23979
Sequence length 965
Comment pep:novel supercontig:GCA_000297895.1:scaffold1841:48203:72597:-1 gene:CGI_10008268 transcript:EKC23979 description:"Microsomal triglyceride transfer protein large subunit "
Sequence
MIMINQSTDDVGLFWLQLLKYIIRFTTQIDNVLPFKYVTVILASVSYGKTVGFQLSTEFE
IGEIFRAGETQLLKVQVTTASISSFARPEVKGELVKLIKYPIYFEYTDGVIGRVYTSEVE
SIFCANVKKGLLSLFQLQETEGQRDEIDVAGECSAYYAVYGGRITKTKQNCQNVEIAGEY
ENVNKMFGVSPDNSFVTHYDTADGIIKSATGSSRHSIVINARPQLSAAVAAIQRLHYVSD
AAGAAAISANNIKEALDLIYKGEAKKYREMLLPSGPEVQECTENCEKPVSILQNVKEDLT
SEKLSKIVSGKAYLKLLRAFRNSGKASIEEVLTHKDSYNIVKQLIDVAAATQTPAAHEAL
MQLITFTDESAIDYPERFILASAYTTHPGEYLLKGMLELMKKKVPNESLRESIALGMGAV
VNSFCKPYGNCLEYSTIAEYVNYVETEMKSCEEEECKLLYVRSMGNAGLAKFLPSLLNQA
LNSKSSTVSLTAIQGLRRMKISDFKDQVNQVLKSIFHQNKRNYDSSVRIAALEILLQNGI
STGGLRNIVLSAMYDQTEFEVSTYLMKRMKDLSESDPKFRSSLAVVLSDPMVNNYNLFAQ
KGKSSAFTGYLAETSSANCTYGLYQENTKSGVMKKSAMVVNVLNKQATQPLLTFGIYADG
IEALVGDAAEGEESTEATAGLSLTMMDVLLRPVEFFRGMSGLMTAVWNAPSEPVSALQGN
LLLQDYSHKIHLSNGLIVDASVLGVASIDLSGKISISLWYKNSHSVITNSGALVVEGSLQ
IDSEELKSGVRFSTESEAFIDFQTDVDFAEMPILGEVNAIDSKSPGEGIVQAAKEIHASF
IVTGTRGLGKVRRTILGSVSDYILRHAPMPVVVCRYVEKKGNLLRTIKTKSEVNPNDIAV
DGDGDLLYSDWGTKTVNKVKNGQTEELIRLHGWKPSRLCVASADKLWILVLVPRMCTDVT
FVIPP
Download sequence
Identical sequences K1PY02
EKC23979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]