SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC25232 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC25232
Domain Number 1 Region: 1065-1218
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.92e-49
Family Adenylyl and guanylyl cyclase catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 271-652
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-45
Family L-arabinose binding protein-like 0.00021
Further Details:      
 
Domain Number 3 Region: 759-1013
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.86e-43
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC25232
Sequence length 1231
Comment pep:novel supercontig:GCA_000297895.1:scaffold1720:159591:211734:-1 gene:CGI_10011947 transcript:EKC25232 description:"Guanylate cyclase "
Sequence
MQEQYQTFARAIYCNKEPENIHLVPCHMTKRAYHANFTVFRKHRGSVEGMAKGCVPFNCT
KSFAAVWIRDTNLILVSSDQNCNCSGVVDEVATMNSDPIEETTECGCRGLLASVPVLSVC
TVQWNLNNILSYVDISDENPGPPRCDDVIRPANNSTFYFCWMGPNDMSVGWLKGYQVFLS
VGDNPREILSLLITFQNDTWRTASTKVKKTSGSYMANAYVWSLPTIAENDATACSVSMEL
NSQDSATAEEQLKVMADLDARGCYIANQTDVGVLLMTDNFLPFDMQRIAPAIDMGQRDAE
KVFNISFKLILSNYSTDCDGAWTESVGKMAELFYHRNVSVFLGPACSQGVASAGLLAEYM
GVPLVTGVGDLLERSPIEKKGYKTTTILSYSIDKMSVSMKQILLQYGWRHTAILYDEDEV
FFRRVGKNLALDFRQDDTLSRPYERPFSNSTVDFSSILTEASKFARVFIILSQAHQFRDV
MYDAYRQNMANGDYVFITIELFPSAHWGHYTKFTDQSYKDSYKNEYVKRAYESVLVLSLM
RQTGDLYNKFKSEVKVRALADYGYTLEESETVRRFPSFLETFPALDEVVAIDEFGDRIAD
FDVFDLRDGDSDPPAFEVVGKFFGSTLLYSPVPGVEIKWIKGIPVDVPDCGFTGELCIRN
RNVDQTTLIIIVCFLILVIAICIVFIIGYYFHRKNHALYEMKWKINWEHVQFTLSGSAGI
FGSFKSSILFSNNESVRELDVLSTRTCDTGRQMFGTIAYCRGVVVAIRKFSVSSIDLNKK
NLLELKQLFSLRHQNVAAFIGACVDVGKVSVMVEYCPKGSLQDILQNESIELDWTFKCSL
IQDIIMGMQFLHGSDVKVHGRLSSSACVVDGRFLLKLRCYGPKCFYEVEEKKKSKKEVLN
YNKLLWRAPELLRMKEWNPGTQKGDVYSFGIILQEIADRTAPFDSYDMVAFDVVHKVKSG
GRPPFRPEINDNYSESLNLLMTECWSENPDNRPTFDVIVKRFKTIFRGRSNNIMDNLIRR
MEQYANNLEGLVEERTKAYVEEKKKAENLLNRMLPMSVAKSLQLGQSVDPETFEEVTIYF
SDIVGFTALAARSSPLQVVTLLNDLYTCFDSIINGRRVYKVETIGDAYMVVAGLPERIGS
LHAKEIADLSLTIRESVRSFQISHLPNEQLKIRIGAHSGMVVAGVVGLTMPRYCLFGDTV
NTASRMESTGEGMHLSLSLSLSLSLSLKYIS
Download sequence
Identical sequences K1PMJ6
EKC25232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]