SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC34262 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC34262
Domain Number 1 Region: 686-1046
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.24e-68
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0069
Further Details:      
 
Domain Number 2 Region: 546-694
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.67e-24
Family Lipovitellin-phosvitin complex, superhelical domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC34262
Sequence length 3620
Comment pep:novel supercontig:GCA_000297895.1:scaffold630:492336:537451:1 gene:CGI_10018340 transcript:EKC34262 description:""
Sequence
MCLKEEIISDEFHEKKYFFEILYAETNKESCKDLLQGYLTGQLSSALGRYQVKALRRDFE
SFSNDVKKALKEVKEKQVADIKTIQGDVGGSWFDHTGAAVNPLCLPKNPEWGIYKDGTDG
GKAYMYGGEYQTDTVPAYMRTLFQHDVPCAVCLVRKRSVVQMFPARKTCYTGWRLEYHGY
LMAGYHGQKAGSTYTCVDSHPDTVHGGHANKNGYLFYPVEARCGTLKCPPYVEGREVQKK
TCYAGWKLEYNGYLMAGHHGHTAGSTYTCVDEHPDTVSGCQANTYTPWRLDVSMGLLLFL
ILLAVAGADTNTGSCKDMLQGYLTGQLSSALGAYQVETLRREFKIVTDQIEKSVNKLDEK
TKAALSRHIVNRSSGIVYTRWGKKTCPATAELVISGYTGGSHYSHTAAVVDPLCLPRDPE
WGVYTDGADGTKAFVYGAEYETSTSAGSLQALHDHDVPCAVCLARNKSVVKMFPARKTCY
KGWNLEYHGYLMAGHYGYSAGSVYTCVDNHPDTLHGGRADKNGYLFHQVEARCGSLKCPP
YVEGRELIVLSLRALGNSGHTSSATATVNSCISRKDNPMEVRIAAIEAFRRASCDNDRTE
ALKVFNDKEEDAELRIAAYLAIMQCPSKSIITTVRNALEKEEVNQVGSFIWSHLTNLMES
SSPFKQDIISILNSEYLKKEFDMDKRKYSRNYEGSFFLEKINTGASIESNLIWSSKSFIP
RSLMANLTVDLFGKSVNILEIGGRVEGLEYFLESYFGPNGYFTEKDVKEATTQIVKGIDE
KKMKKIDSQFGTGMDQLRGALYMRIFGNELSYNSFDGLASFSSGFNVLEMLISMSKNHDY
TFTQNIMFMDTSMIIPTSAGFPLNLTINGTATIDMKASGKVDLRKLGTSPRSLLISGLIQ
PSTAVEISSMMSVDAFVTKSGLKMVSIVHSSTLLQGHVELRDGTIFNANLDVPKDKMEIF
SVKTAFFTVHRDVEKEQNMITKNRKIHKTCTGSHLARITGLKLCGEIKFPNASLETSAPY
FPLTGPISLDVSLMKEDSHKSYNVEARLSKTKKEVNIRLAFDTPGSQTDRALSAEFLLDK
IGSKLQMGLQSPWNKALFTGKVENEKNLRHISGKFVNNKQEYSVVAEAAMTRKGNTFEYT
PHVEISAPKMKSIQLKGGMKYSGMKLIDAKLILIGVSKEPIKAEVNFVQKRVVVIGKASI
SFEKKKEYVIESRVQKYATAKAARYRPYLSIKTPEKELVSFGGSAEYKKGKAIKVDLTVD
RIVSKPIKLSVQVRDASNKKSTGFRSKIDIKSPVFTTKLTSTFMLKNQKMAIVRSTLDYV
IPKVMRDKNVNYQMKGKHVQSLKSIDSSLDVVFGKKSSYSAAIELKNKSKKLASFVGKLG
ISVPGRDIVIGNVFDQRTAKKYTNILTIQLENGHKSIIESTLRNVGTNEYDISTSFNIPT
YDVLAVSGQYRFIPSNFQANSEILYGKTKYAVSLSSLVRIGSRIQVAADLEYPARKVTAE
FDTIIKDPVFSSKLDVKWDANQDLDKKILIQGDITYEGLQNMEATFSKSSPLGFGNVNLK
HRSGEKYVSHAHAEWNKDVVSVDSSFGKKNDGYIADLKIESPFKDYRSINIGLSHQLENS
KSISNIDVDWKPMKRMSSTLNMKRPLHFDDVDVSLEIKSPISGFERTGIELKHKIEDGVM
SFVKFSWNKDFFQTDILAVDKSSASNRDLTGRLSVKSSLDQIASLSVSAKHVDNGQKFEN
SLNFKHNGNVYAYQGDVHHFRNGWQLQNSGNIKLSSPMKQMESSWFHRNTHDDLQSSLKF
ESGANVVDIQVKGMQRMSLPQGSLTFDFAMRSPFNRDLALAVSHEHGIGMIDNKIHYSTE
GKKVISLSNVYKRNNGVADSSHVFTCHGSTKMLTVTSQYQQYPITGQIEYQDNGKSVSKL
NGQLDFPPTGLMSGKIELISQFSGYESLKLSVDQSNERGEIVTRSSLSLPSRNTITMETR
GQWGKKKSFNTILSTPYKNLQKMTIGADFTGDSKSFHTSANLMINPIVGPMSVTSQWSSY
GGIIASIQINTPFEQHRKTRVSFTHSNQNEKKVTELNVEYLPGKIIKLESSLRPTLDNLE
GSIALTTPFQALPYSAASLRHSGDSRQFQCHGEIEYTRGKKIQGDITFKNDKKMETTLVI
RSPFANDLTAAINHEGTWSQFASHAEMQYGKSKKYEITGKYGNLAGDLSIKSPLHDDIAA
SFNHKGDISEFDSHIEGSYGRGKKYELTAKYNQKSGTIGLKSPLYEDISASFNHKGKLTD
FVSQAEFQYGGSKKYEAMAKLSLAKTWTGSVSFSSPLTDDFATSFSHEGQLSDFQISADG
KYGKQKGSVAAMFKKAKKTIGSLELKSSLIDNIKAEFSHEGTLSNFDTKLSITKAGKIVY
EGSVSFSNGRKVTGSATLKTPFHKDISATFKHSGDFTAFQTAADIKMNKKTEYKLSADMV
NKKRTKAKLQIENPFTDPITLTLVKKGKPTNVRMIANAILGKGQKYTVDITLKRGSNSAF
IIGITTPLPGYKKMKGNWNFSGNMRNFKTSARAAIGKESVSADLKMSLRPNFKADVSIET
PFKGLKKAGVVLSHQGSLKDFKSHGEITVGKSKLYNADVMIATDPKLAASFALQTPFRKV
EDFDFSMTHDGSLRNFNNQVNLSLNKKRISSGLKIDTRSDITADVSIQTPFEGFEVLQGS
LTHIGTWNDFQFHLEGLDGTNNKFTSDITLRLNDQIIYDMKLTTPFKSVELLKASLSHDG
TINNFHTHGEFEMNNDRSEIDVNFSSLVKLEGRVLLKSAYIETVEGMFAHESLPIATSAT
LRYGNRNILDSKLSVNSSPLQGSLLLNSMYTRPLKAVVSHTGSMKKFNSVAEIAYGKETM
KYTTEFDSTNDISAKSSIVTSFGTVKSISSSVSHAGGWSNFKCHADVSINGKAVEGDVAY
NSRDSIEGSVVIKTPFENYRESELSFRHNGRLLNFNSRAEYSLEGQKSEVELTIDTDNKV
HINVLMKSPSIHDISFKLNHNGYGRTFKSETELKYGGEKKIEGEVSFEAVPKMTLSAVLK
SKCPVVKSIQISISQEGTFENFNVQASASFNDQRVSSDVRLDSRSGLNGRFLLTTPVSEE
ITASIKHEGQMANFKTVSEVSYSGRKQIELDAAFRLSQSVTGQFSLKTPISEIADVNIIF
RHDGNRSNFKCSGSASISGDQKISGDISFNSQPLSGAWNIRSVFGNLDGAFDYALSSRSM
NSHVEINVNGKHSEADMTYSNNGIQKGSISLSSPFNEKIGASFTHDQNDDQISSSMTLYS
SDKTITGSTEISFTDGISGKLSLITPIEGFEQQSIIIKYSNNSDKMSSSLTIEFNNGQKI
DGQMSLSKRGSLEGKIILSTPFEGFRESKADFTYDYSSTGLKASAKGTFRQQSISADMSF
DKVPFQGSAILRTPFVGFEEIKTSFNHASSDRSYKSHIEITMRGKTVQIDSSFSNKNSIS
AATTIMTPIKGYSVVSVSLNHEMNVKGFSNVAKARIENNEVSVEATFSNMSSLAGNIKIS
TPFSGFEKQSGSFVLNQNNIRVEAAARDQKIEIEGTKSNGNGQISLKTPFEGFKSQEISM
TSTRDSINVRGLAENTDHRL
Download sequence
Identical sequences K1QBR5
EKC34262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]