SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC35947 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC35947
Domain Number 1 Region: 1485-1634
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000523
Family Tropomyosin 0.0034
Further Details:      
 
Domain Number 2 Region: 1649-1792
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000036
Family Tropomyosin 0.0052
Further Details:      
 
Weak hits

Sequence:  EKC35947
Domain Number - Region: 1021-1133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00432
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 1154-1383
Classification Level Classification E-value
Superfamily Tropomyosin 0.00595
Family Tropomyosin 0.0057
Further Details:      
 
Domain Number - Region: 1782-1984
Classification Level Classification E-value
Superfamily Tropomyosin 0.0235
Family Tropomyosin 0.0084
Further Details:      
 
Domain Number - Region: 506-622
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number - Region: 340-431
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.068
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC35947
Sequence length 2080
Comment pep:novel supercontig:GCA_000297895.1:scaffold501:159121:185490:-1 gene:CGI_10027502 transcript:EKC35947 description:"Rootletin "
Sequence
MSEDFQIEKEGSDMESDVPEVPRPGFVRQKVDALEQSLRGQGGESLEAPSKNLVQQNIEL
RRKLEDEHASYKRKLQAYQDGQQRQAQLVQKLQAKLLQYKKKCTDLEDAMRNKDFHYQFA
NQKYKKKCEDFEAENGDLKSRNDNLKLVLQYKHKCSDLEDQIESKLQSTEESYKKSLEAS
ESRNMDLENTLIKLEEEQQRSASLAHVNAMLREQLDQATAANQSLTSDIHKLTQDWQAAR
EELDIKEREWRDEEQSFNEYFSAEHGRLLALWRQVVAFRRSFGDLKTATERDLSHVRNDV
TRASRSMHSACLNLAANVRNSDTQSQVLLDRERSDRAAIDNQLREKNREISELQSRYDAH
SYELNAKVNELTMMNEKLKIQLEERDKSINTLQRQINNLETRLGERTSYDLPETDTARQI
RGETEALHDALRNIAEAVINDADEFDGEEGRRSISPSRARSISPSARARSPMLRDRSKSP
MARSRSPALADATFSAVQAALNKRQLQLSEARAKLRASQDHNAAIRKQMDDLDNERRRME
LQILQLKEDVDILRREREDTSRDRDRVKNALSLTGTEKSQLEKIRNELNEQIEMMQQENE
KLQAANTDLQRQRDQLEDEKDDVTKDKERQVKENDRCHRVIDQLEHKNSTIKEELVSTKE
ALNRALLDKEVLEQQKSEVSDALSKAELQKAELELEINKAKTEEATLKDALLKMQAMNEG
LGQDKVELNKIIMQMEAEQASLTGEKDALEMEKTGIKEELTLELSEMTRQQLEEEIQALN
REKGDIQEQLSSVSRQKQALAEELLQARREVERQNQNYVKVAKEKEMLTQDKGELIVQVT
ATERENRQQSEVISSLRSEKDSLESALYESQQSESQLNVRKEQLEGENQELILRKENLQS
EINRLIKEKEADLEKFDRIKEDLQRRLTQFERDMSLALTQEKQAHEDDVERLVKEREQQR
HEFETERDENVHQNAMEKEELLNRFDREREDLQEELANLQRERDNQLLMAENDKQQTMSL
LEQEKSTLAEKNNTLTMELANINVEYERLKREYLARQEQDKNNMNALNQELRNLRGQFED
TCMNHQKEIKDLTNQIRDLERQREAALREVADLKTQLKLVEEARDNVRRDLIDSNRKVRE
EEEMLELMRKDMVELKRNLNDEVREKELFSKINDELRGTIKKNEGEKTELNRDLCDHRQR
CSILEEQKANVQKEAADLRASLREVEKARLEARRELQDLRRQVKMLDGERSKLGKEVNDL
QARVAKDEEKEEEGRRHAFDLKQKVVETEASREAVRKELANLQRKMGELIDESRLKEKDY
QMALEDSRRAERKLEDQRRNLEINLENTNAEAAELKLRLSGSEGRVNALEAQLARIEGAK
QDVEFKLSSIVSSLKRTIGFRQEMPRARSPVRSRSQSPRRSRPNSPSKGFENTYATTTEG
RGSPIPRTGSPERSGSPHRMSRGASPIRFDRTGEVNALDVDPEAVRMALRDFVQQLAGAE
RERDDALANVRSMAIQLKELEEEKDRTERRHQILQKSLGDVEEDKRGIDSRLASAQTALM
LQEETIRRNERERKVMTDKINSLERSLAAADTEKRQQEEKIAKLKANEMRNDENRKALKM
ALDEAENRCTKLELGRRSLDGDLQRFKLVMNDKETENQVLQDRIEALNKQIQGLESKSQS
LQLTIDRLSTNLQKTEEEESNQKERVQSLNLTLSDNQAIINELQDRISQLQKGLTSSEHD
RRVLQERLDSTRQALNEAKKQNHGLLERVQGLQNEVADSDVRRAELEGQLRQSHTMLVQR
QEREQDLNQNIQKISSEKQLLHERVQELSRQMANLETEKSEMERSSARLEKDKSALKKTL
DKVEREKLRTEEIASKSVMEKGNLDRTLNRLEDDNTDLQKQVQQLQAQLAEAEQQHAQRL
IDLTTRHRAETEMETERLRSAQTQAERMLETRERAHRAKVKGLEETVATLKDQLATEMRK
RQQYISRSARTGDEIRDIRSVLDNSMTNVMRDQSLDPLLLETETRKLDDSMNFERSYPSQ
SAPRRRLSPGRDYRRYGGLTSTPNVRRSMSPLSLRKKLQK
Download sequence
Identical sequences K1QGF9
EKC35947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]