SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC36554 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC36554
Domain Number 1 Region: 13-140
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.92e-16
Family L-arabinose binding protein-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC36554
Sequence length 148
Comment pep:novel supercontig:GCA_000297895.1:scaffold462:1402:8627:1 gene:CGI_10000714 transcript:EKC36554 description:"Atrial natriuretic peptide clearance receptor "
Sequence
MRACEEKWIFLGTFDKVGLAVTGIMKAFSWNRIGIIAQKHTDVIWMYTMDAVKSMADDHG
MHVAISKTFNGSENLYDLLKQVAMTSKIIVLAVRGDTLRALMIHAYDMGLIKENYMFICV
YYYSQKNTFGDISWKQWMECVVPSTLRK
Download sequence
Identical sequences K1QZI6
EKC36554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]