SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC37250 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC37250
Domain Number 1 Region: 27-342
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-33
Family L-arabinose binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC37250
Sequence length 374
Comment pep:novel supercontig:GCA_000297895.1:scaffold412:198711:213648:-1 gene:CGI_10018563 transcript:EKC37250 description:"Gamma-aminobutyric acid type B receptor subunit 1 "
Sequence
MRSVVPVFGCGLALFLFLGRVKSKVPLHIGGILGSTDDSWSKYANFYNILFQVAFEEIGR
TDILPNHELVFESKNSQADPGLAAKCLFELINEKPVKIAIFGPPKSNPYEIVGQITPKFY
LTQQMNEFHKLLDENNITLVTSGIITDVQEVDVVIKRLKQYGARIIIGAFRSTKAPDIFC
EIYKQKMFGKKYVWILTDSLYKGWIGKLEEGQESCAVDNIKASAYGHFTLGQKQLRTDNM
VTISGRTADEYEAWMKNISAQYNSSTMLLSKYSPWAYDAAWALAVGLNRSIKHLGGGELE
NFSYNRSDIYDAIQKGMEEVFFQGVSGPVSFKDGRRIGPAFIKINHEKYDDTKSEYWVEG
TGAFKLEIIRQDIF
Download sequence
Identical sequences K1R7S6
EKC37250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]