SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC40739 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC40739
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily ITPase-like 1.15e-62
Family ITPase (Ham1) 0.00000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC40739
Sequence length 189
Comment pep:novel supercontig:GCA_000297895.1:scaffold157:66459:67613:1 gene:CGI_10021224 transcript:EKC40739 description:"Inosine triphosphate pyrophosphatase "
Sequence
MQEELKEIVLCTGNKNKLKEFMQILGPDFPYKITNVDVDLPEFQGEPEEVATEKCKLAAE
RLKCPVVTEDTSLCFNALGGLPGPYIKWFLKKLGPEGLHKMLSGFEDKSATAMCILAYSS
GEKDSEVKLFCGKTPGEIVAPRGPNDFGWDPCFQPDGFKQTYAEMPKETKNTISHRYKAV
ELFKKNFQK
Download sequence
Identical sequences K1RAR4
EKC40739 XP_011454786.1.10878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]