SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC41374 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC41374
Domain Number 1 Region: 132-229
Classification Level Classification E-value
Superfamily TAFH domain-like 2.49e-32
Family TAFH domain-like 0.0000627
Further Details:      
 
Domain Number 2 Region: 336-383
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000469
Family TBP-associated factors, TAFs 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC41374
Sequence length 546
Comment pep:novel supercontig:GCA_000297895.1:scaffold121:380028:387350:-1 gene:CGI_10025646 transcript:EKC41374 description:"Transcription initiation factor TFIID subunit 4 "
Sequence
MATSAAFRPQQISIAPRPGTTQNTIALPPGVQIPPGAQLVRNEQGQLVFVIQQPAATSAA
TGHRMFVRQPANSPGPVRPHQIVTIQPPGMNRQVNLSTAATTATPVSTLIRTTAPVGAPH
TTPSGAPQQPPDNVKKCKNFLSTLMKLAQSQPQQTVKNVRELIQGLIDGKVEPQTFTEKL
QIELRSSPQPYLVPFLKKSLPALRQALIANTMTIEDVKAPPLEVLQPVVSIGNLVHTQLH
PSTHHAAVRGQHVIGIPKTVTAVTGKAPHHTGLPAQGRTSTPHKEKTKYDSLKDDDDIND
VATMGGVNLSEESKNILASNADFIGTQIRSCKDEAFLYHGPLLARITAIAKKHGIDDISS
DVANLVSHATQERLRDLLEKLDTIAEHRIEIYKMNERFEASTDAKSQLKFLEELDKMEKK
RHDDQEWEKIMKAAKSRSKNEDPEQQKIKQKAKELQQAEIERMRQEEANQTALAAIGPRK
KRKTDFGEISSSGSGGLSVSNGGSSSSKTTSTRQRIKRVTLRDVLFLMEQERSLGKSTLL
YKTFLK
Download sequence
Identical sequences K1RCI1
EKC41374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]