SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EKC42518 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC42518
Domain Number 1 Region: 1025-1131
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-21
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 2 Region: 224-327
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.36e-20
Family Ras-binding domain, RBD 0.00012
Further Details:      
 
Domain Number 3 Region: 356-459
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.41e-19
Family FHA domain 0.0000423
Further Details:      
 
Domain Number 4 Region: 43-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000138
Family Ras-binding domain, RBD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC42518
Sequence length 2715
Comment pep:novel supercontig:GCA_000297895.1:scaffold57:152046:188805:-1 gene:CGI_10020544 transcript:EKC42518 description:"Afadin "
Sequence
MTDKIQDRQRLANVITQWNQDHYDLFELSQPNEACEFHGVVRFYFQDGTNVVTKCIRVAS
TATAREVVDVLVEKFRPDMRMLTANKYALYEVHANGEERRLENGERVLWVQLNWGTDVRE
GRFLLKREGDTTLAHARAGGGVDKENQGGTFKRKLSKREKKEQKKKEKEKKIAEAGSAAE
QLYTDMPETRFTRSISNPEAVMKRRRQQKVEKKLQQCRGQDGQGGTLKIYGESIKPETPY
KTLLLSTADNVRYVIRETMDKYGMDFTVSDPEDYCLVQVLVPPGEREYHGGNIGEERIME
DHECPLAIAMDFPPAKGTMMFHFRKRPNDAKKTKHKKLRAVSHEELRTKPEESPMKYPYL
LELNPDGSDNPKGKIYRLSMSYTEVGSDPSMAIKIHGPNIQPCHCVLGLVEKDGVVTVTP
NSPESETHVNNQRISETTTLQNGMTVRFGKLHVFRFIDPNFEEKLRKGQIPPDGAIQKHR
MQHQKSMEPSFEPTRPTPSPREPRQQEPMETQRRNVPPQPMGSPRREENAYPPHRQQAGD
ALPAILEFREDKEDHFFANIILDSATAGIQFKLAPTYTIYLAVRFSLSNGYRPDLSPQDK
AVRITNLVIKIANLTHQAIHEDHFFANIILDSATAGIQFKLAPTYTIYLAVRFSLSNGYR
PDLSPQDKAVRITNLVIKIANLTHQAIHSHRDNPAALAFWMANSSEILHFFKQDHDIHPF
SQDAQEMLAESVQTAFHHLNRCLQYDLQRTLPAFLDDSDDDDMNEKNRMQYNRGRPSLGD
VLDTLSSAMNLLRRCRVNAALTIQLFSQLFHFINMWLFNILVKEQHQFCMRIWGLRLKRR
LGSIEAWAEKQGLELAADCHLCRIIQAAHLLQARKSSPDDIADITATCFKLNSLQLRELL
QRYIPEPDEPPVPQQLLEGVVKIAENMADEQIKSDGREVCLEEDADLQLPFLLPEDGYTC
DTIKGIPKGIEEFIEPLAKGGLCRMIPQPGTSGDWTVYMTGDETPRIDEAVRKVPQQHQP
PANHHGDRPQQQLPKEPEIATVTFNKVKGSMGLSIVEATPKSEGQKVSGIYIKSVVPGGA
AALDGRLQAGDQLLEVDGKGLVGLSQDKAAELMTKTGQVVSLKVVKQGAFYHGLATLLSQ
PSPILPRASPKKPSSPQSNKHRPQEEGPPPYNPTPDMDRVRGMDPRQKQAMQSPHNRSSP
ALNKYRSGISSKEMEVIYGRKDALWRTILETDLHAIISNRKPDPESAPGAFSYQNPRSKS
ASNLEEDTRMNIGIVDRIAPKPQTQANTKPVLKENQKKKKNSVVDLRDLQADLSKYRSQG
QGQTGHRPRSKSVGEMQRPRHSVQHNAPHQNLGYPGSTPKSVHPQQQTYLTDENMNSVPV
DKAQSRSSFQNLKARHNNKMRNNGLQRSQSAGSVDREQSYNPESYTVYSQAVSPTPYCPQ
GPSNLTPQHSRSHSASQVQSVYPQTQQYAHPPQSPYKQIPQNVPHYQGQQRPRSMSQYQG
YVSQYQGHPPQGYQGQTRHVPHPQNTRQVPVRGPHHQRSRSSDLVPTRGDFFLGESYDSA
RGSDSIQSYGVMSPLESYNAFKALMKNTNSDSGISDSRESKNSYYDSGEPLNSPYPVFSP
VSPHMLNSTMRESWDRSSLSSSANSTMVTAGHGSLSRKSRNKIQHFNQNGRDTLPGGRSM
REPPHPAHRPGHHRDPREQENKSKSMANLHMDNSFDHRDPPHHTHNMRPAASVGALQHPN
APFQEYYNQGRNDPRGNDYENHPSVDPRIPRNQQDPMRNHGYHDVNHNVPPGHLVKPQLR
ESVEQGSPSSRHSGSSGRDERPQSAYFAHHPQPDFSREERPKSMEVNLGKMQEMQQRYGQ
PQHSPHQSPHERSFDSERDPNYYNMNMRAQQQQQQQMQSGYVNQSDIPRYTANNESRQLN
FYENTSPRQNEPSPAFHQLKASEPGHSEGKRPPPTMPKPSVAPKPNGPKVTPADIPRVEV
DNRHTQSHFFEPKIQQQPEQRSPKVPSSQSAYIPGRGVVPHSTGFQHDPRTNSLPRGKFT
PPRDSNYHPQTHQSPELPPPPQETPPELPPPPAPEDLPEELPPLPPPPANDYSLDPQYAN
SADPRFGSAGGFQQQGRFNQPQQRVLPQQQRNMGYVEPQQQFMQPPHSATLPNRFQQPSN
DYQNIFNEKQNRSFESSMQHPTNQNVYESYNPKQPPMKVDPQLSKHRLISEVSEIAQKSQ
KDGGPLASPWDREEQEKLNKAREEQMSHLREQEIHDLESRPYLSPQEQDRLKKLRLEQEF
QRRVQECSNRDDEDEDSDNDITSRTQVGREYLIQAIQEDISKAHRKLEELNHKQMYEEYE
REKDRMQRLERKLEMFELEKEERQQRLQKRQERKLREQEEYQRKQRDLREKQRQDYEEQK
RLMMMEEERLMKKKQEEEQKRKEMERERLRELEAQREQEEARLRAEARQRQEEQHRREIE
IRERERREQEKRDQELRVREEAQRLEALRLQNQPQGYNQQYANLPAHSQYGAPAPPVRGS
SYDVHGANRPNERNPEIQNGFRNMNNSNFRNVPETVPKKSVSFNTQLETRNTYSVGSESD
RTPYASQSSYRSSTSDQTEPHSPYGQPPTPDHAPDNVFDSTGGTPQQNHVSYKTTEITPT
VVGSQEVYRDPRNRIMAQKEAQGGSTFSKKPVSDRMSFRDKMKFFAQEAGENTPKEKPKA
SKTLRNIESQLHNGK
Download sequence
Identical sequences K1R9Y0
EKC42518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]