SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFQ91566 from Pyrenophora teres f. teres 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ91566
Domain Number 1 Region: 82-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.5e-44
Family C-terminal domain of adrenodoxin reductase-like 0.00000945
Further Details:      
 
Domain Number 2 Region: 9-138,305-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000388
Family C-terminal domain of adrenodoxin reductase-like 0.00091
Further Details:      
 
Domain Number 3 Region: 342-452
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000383
Family N-terminal domain of adrenodoxin reductase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EFQ91566
Sequence length 452
Comment pep:novel supercontig:GCA_000166005.1:GL534705:603:2011:-1 gene:PTT_11539 transcript:EFQ91566 description:"hypothetical protein"
Sequence
MNKNKDAVVDMYEQLPVPYGLVRYGVAPDHAEVKNCQDTFEEAAQSPRFNYVGNVRVGHD
IELVKMKPHYDAILFSYGASEDRQLGIPGENLPGVYSARSFVAWYNGLPEFKSLNPNLQA
GEQAVVIGQGNVALDVARMLLTPVHVLQKTDIAEQAIQTLSESKVHSVRVVGRRGPIQAA
FTVKEARELMNLPSVAFEPIDRSLYPADIKKLPRVQKRIGEVLLKGSKTGNQDASKRWAL
DFMQAPKSMQANHGHLSSLTFTKQQFVPDGDPFDQTTRVMPTNEETSLEASLAFRSVGYK
STALPGLSDIGVPFDEKLGIIPNDMHGRIITPSAGPGNLTAGHVPGLYCAGWVKRGPTGV
IASTMQDAFASADTILQDWEQHVPFLNDTSGDHTSTGLGWHGIQKEVEARGVRPLSWTDW
KKIDQAERARGKEKGKEREKFQSVEDMLVVLG
Download sequence
Identical sequences E3RRS2
XP_003300327.1.2082 EFQ91566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]