SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFQ86436 from Pyrenophora teres f. teres 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ86436
Domain Number 1 Region: 19-108,240-476
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.85e-70
Family IF2B-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFQ86436
Sequence length 483
Comment pep:novel supercontig:GCA_000166005.1:GL537410:31904:33472:-1 gene:PTT_18328 transcript:EFQ86436 description:"hypothetical protein"
Sequence
MQRATIQAPGLSTYLKSLKSTPVDASVEHFISLLKRRQIRNSRPCAIATTALLLRVVGEF
KGRDAAKLIERIKQVGRRLTSAQPREVVVGNIVRRVLALVREVVEEHADGTPNGSERGNT
TPHAHRDSLHRPALNSTISTFSPLRHAVAEPMHTGPFTDNASDVSEPSRRPPLLTSHTSY
APTSSAPLVHSLFGLFSQPADTPSATSTPTGQASPNGRGTLTALNLERLADISRNPNLDL
KGEVMEGIRELQDELETSDKQIAEVALEHIHANEIILTHTASTTVQKFLLFAARKRKFTV
VHAETFPHDHTATHGILLTGKKREANPDDDEEDDKWKPLTDAGIQVYVIPDSHVFAIMSR
VNKVILATHTVLANGGLVAAAGAHMIAKAAKEHQTPVVVLSGVYKLSPVYPFDIDELIEY
GDAGSVVPYDDGEFVDKIDVVNPLFDYVPADLVDLYITNLGGHAPSYLYRIVADHYRSED
ITL
Download sequence
Identical sequences E3S6H0
EFQ86436 XP_003305475.1.2082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]