SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFQ90742 from Pyrenophora teres f. teres 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ90742
Domain Number 1 Region: 16-103
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000212
Family B3/B4 domain of PheRS, PheT 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFQ90742
Sequence length 107
Comment pep:novel supercontig:GCA_000166005.1:GL535099:62047:62370:1 gene:PTT_12619 transcript:EFQ90742 description:"hypothetical protein"
Sequence
MSRSGKKPTKPLAQNPQKTMNSLETLRRVNAGLPRVNRLTDIYNGISIKHQIPLGGEDID
KYNGSPILRRAKGDEQFETMSGGEVAIEYPTPGEDVWCGDKGVTCRR
Download sequence
Identical sequences E3RU73
XP_003301178.1.2082 EFQ90742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]