SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFQ96501 from Pyrenophora teres f. teres 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ96501
Domain Number 1 Region: 1089-1336
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000114
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 301-538
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000179
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 3 Region: 899-1124
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000262
Family Tropomyosin 0.0053
Further Details:      
 
Weak hits

Sequence:  EFQ96501
Domain Number - Region: 503-607
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0144
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number - Region: 591-705
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0243
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 727-834
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EFQ96501
Sequence length 1718
Comment pep:novel supercontig:GCA_000166005.1:GL531883:3799:9053:-1 gene:PTT_00757 transcript:EFQ96501 description:"hypothetical protein"
Sequence
MALGSKAKDLDRPNANTRTASGLENILPASFVDMQKCAGDIPRSQPSSRAMSRTRPSATP
LSTSSLSRSVSSMTDSFMLDHRRSPSAKSPRSEHDGGENSEVPSPKAEDAPTVISNWAHL
SYMKNQRNTLRAELKAHQIAGAEAKRSVTSLRRLAFRMAVNISVKEKQITNTARNLAKSR
TNNYLEGKDAQRRVEELKRALRIEEERNKEILEALERASMLTLEYSTPQDEPQHRPERSF
FSPPPSPPTRSNVPGSPISEPRTPTRPSPSPWNDVDFELTPRIGSVAEIRTSDSRLIRAK
RESDRALAVCRRRIEQLQHECAESEEDNRYLETNREGLEQEIRNHQSQIAALERSRAAVE
ETLQSTKSQLFTMIDSEDRLKQELQAKSGELATWEERGGDMQARIDALQKEKTDLDERLH
EQTAQIRELEIRTTALDESLQSCRSKLEAAERYETSLQERLVEKENTCESLRKRLDRGLQ
HVASLEQKISGYEADTAEQLRKIELGEHVISELHDQIRNSQTMNQNTEDALTTLKEEMEL
LQIKLRSEGDARDALASELETMRTEKTSVEDELRAMTESREQEAAAKVKLMVELEDLRKS
CDTAEASLVQARERIQSLEVADATVQTIVETLRAEKAKIEADLRDTQQLLSTLREDVQTR
DSEIAELQSAKTDYEQKLQASEEQVLSLAKELEQTKSVMRETDEQHAADMAKSDGHLREL
ESSILNLQSALATSQKLEASLQEELRLVRDSKDAVESELGDAVRSKAELQGRVDYVQSQL
TSTASERDGLQAKVADLEKRLETNSDIQASLEEQLAAITDEGTSLRCRVSELETELGDYR
DAKSKVEEALSIAQMDSEASGTELADLHARIEESEAATQEAQAGLYHALRSKSDLENQLQ
SARNKLEKVESKAGDVRSRLSALHEEMSELRQSKEQADEDLKVVSVARDALDHDLQDSQS
QLHAVQAKVSQLETRLSSTEEELEAMCRAKVAVEKRLKETLETTAELNEELDVTRKENAD
MRERLDSMTASNANLEEDLGVTRSQLAEIDAENTHLTSKLCDAEEELEGLRQLKDDVEGR
LSEALAASMTAEQSLASTRARLEELESRDSRMVAELAQTRVELDALEKTKVELEGKLDAA
ENNTESLQVDISSMHTRMAELESNTATLLSQLAASGKELEELRSSRAALESSFQTASARS
GDIEAELHAAQMRLSIAEAESLEAMNKFLLANKELSSLRDENERLDASGKELLTRLATAE
EELNTARENNTRLGAFLERVESDMTKAQTAVEETEKRYHEFVQSAQAKLEAAESSKLRFK
DRLTERNNELETLINENSDLHQQIGDQTRELGALKKGKGKLVEELSKKEKYIEELGSSAE
KRLNSMNSAYNGLRQKFEKQQSQQQRLDDDHETALRLEAELEKKMTEIEEMHHNQEESVA
SFSALEKEVENLKNDKRAFEKLVATLYEKMRHLDILDEWAERNERSETNQAGSQRHITIQ
DEPYDTAPSSPMSAHTRSSIGLGLHISGQHDRPVTRASTVSHEDDDTWARQIEEARMQRN
EAALLLSGMKKSRHNLKKTLRDTDAHLHRLEKDTKAKHYPNLLRKKSRPMNPTPDQADTT
IVSRSPQTPTRRKSSHGFGFSPRSNQRHSTYHFPPYSEARSTALMTSSPDRPRTSHGIRD
RLAGRKSVGDELGGGSGGGKEHKRRWSQGLRGLFHKDS
Download sequence
Identical sequences E3RCP1
XP_003295396.1.2082 EFQ96501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]