SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383783921|ref|YP_005468489.1| from Leptospirillum ferrooxidans C2-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383783921|ref|YP_005468489.1|
Domain Number 1 Region: 37-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.45e-40
Family PP-loop ATPase 0.00078
Further Details:      
 
Domain Number 2 Region: 407-457
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000167
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383783921|ref|YP_005468489.1|
Sequence length 481
Comment tRNA(Ile)-lysidine synthetase [Leptospirillum ferrooxidans C2-3]
Sequence
MNSLDDLLGDFRFFHDTLSRFLERNRLFQNGNEDLQAFVGVSGGADSLCLLYTLSRFPEI
RKTLTILHFNHQTDPERNGMEEAFVRDQAGSLGLPVMTGYRKQAPSGLSEDLLRRERYQF
FDRCLDQSSRPVLFLGHHRSDQSETILMNLFRNRGPRGLLGMSEFRDDRYARPFLSLTSS
EIRAALQKSNLPYLKDPSNQDSRYLRNRVRNELAPLIREIFPPMGIESLSYLAEQMAKEF
RPEIRNIDSLLDHEIRGTIIMPLSLFRFLSPVRQSILVEHLFQQQSLWDLPVAPSGNILR
SLNRTPPLTGPMGNGWLLSIESGKIRLTHNSTEPELDETLSPFFQFRPLDTKSNMEENIK
LPRGGLIHLSSRPIEDDWNLWEMGMKPSRQCVLQEEDLKSLVLGYPFRGAKIKIGVPGNR
SKNLNREILESRISRQERPKIPVLYQNGEVLWAPGVVPLPHSPSLKTGWGVKLTYFPWKE
L
Download sequence
Identical sequences I0IM60
gi|383783921|ref|YP_005468489.1| WP_014448851.1.71101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]