SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383784829|ref|YP_005469399.1| from Leptospirillum ferrooxidans C2-3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383784829|ref|YP_005469399.1|
Domain Number - Region: 65-100
Classification Level Classification E-value
Superfamily PEBP-like 0.0421
Family Prokaryotic PEBP-like proteins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383784829|ref|YP_005469399.1|
Sequence length 143
Comment hypothetical protein LFE_1587 [Leptospirillum ferrooxidans C2-3]
Sequence
MKSPVIQIERTGCAIASVAALAGISYPEMKSIANKLGIFSNDKRLWSETSYIRRMLDRVG
LNADSGEVPFFSWESLPDLALLAIKWHLVKGRPFWHWVVFVREDGRSFVLDSKKGLRNNI
RMDFGRMRPMWYIRVDEGPKATE
Download sequence
Identical sequences I0IPS0
gi|383784829|ref|YP_005469399.1| WP_014449754.1.71101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]