SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|381335643|ref|YP_005202610.1| from Leuconostoc mesenteroides subsp. mesenteroides J18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|381335643|ref|YP_005202610.1|
Domain Number 1 Region: 483-502,536-787
Classification Level Classification E-value
Superfamily HAD-like 4.21e-52
Family Meta-cation ATPase, catalytic domain P 0.00079
Further Details:      
 
Domain Number 2 Region: 292-386
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.83e-21
Family Calcium ATPase, transduction domain A 0.0045
Further Details:      
 
Domain Number 3 Region: 232-289,387-476
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000068
Family Calcium ATPase, transmembrane domain M 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|381335643|ref|YP_005202610.1|
Sequence length 797
Comment cation transport ATPase [Leuconostoc mesenteroides subsp. mesenteroides J18]
Sequence
MANKEDNMNMKNMSAKNMENNESNMSHMDHDDMKMDHNMTETDHNQMNMDHDMTEMDHGQ
MNMDHDMTETDHNQMNMDHDMAKMDHGQVNMDHDMAEMDHGQMNMDHSQMNMNHETMNMS
GMNHGDMDMAGTDMMMHGGSMMHMGNLKVKFWVSVVLAIPVLLLAPIMGLNVSILSFSSP
LIVGIIIVLFDTALYFYGGMPFLKGAKAEIQDKSPEMMTLVTLGISVSYFYSLYAFIANN
FLNPANHVMDFSFELATLILIMLLGHWIEMNALMGAGDALQKMAALLPKTAHLVTDNGET
KEVPVSDLKVGQAFQVRSGESIPADGVITAGESTVNEALVTGESAAVTKNVGDKVIGGAT
NNNGTLTVKISGTGDSGYLSQVMKMVQNAQQAKSKAEDKADLVAKYLFYAAFGVGIIAFF
AWLPQGLATAMTIMVTVFVIACPHALGLAIPLVVSRSTTIGAQNGLLVRNRQAIEASQHV
SHVLLDKTGTLTEGKFTVNALIPNDGIDETTLLSRLAALENNSTHPLAQAIITEAQAKDI
KVVAAEKSQNIPGVGISGNVDGTDYTIVNGNYLTKQGIRFDEAAADKWAAKGNSVSFLLQ
GTQVQGMVAEGDTIKAGAKELISGLQRRGITPVMLTGDNPKAAEHVANLLGLTEFHAGLL
PDDKQKIIADYQAKGNHVIMVGDGVNDAPSLAAADIGIAIGAGTDVAIDSADVVLVKSEP
SDILHFLDLAKITNRKMVQNLWWGAGYNIVAIPLAAGVLSFIGIILDPAVGAAVMAMSTI
IVAINAMGLTGEKIKNV
Download sequence
Identical sequences gi|381335643|ref|YP_005202610.1| gi|381335643|ref|YP_005202610.1|NC_016821 WP_014333963.1.62901 WP_014333963.1.77507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]