SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|381335682|ref|YP_005173457.1| from Leuconostoc mesenteroides subsp. mesenteroides J18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|381335682|ref|YP_005173457.1|
Domain Number 1 Region: 385-402,440-679
Classification Level Classification E-value
Superfamily HAD-like 2.34e-48
Family Meta-cation ATPase, catalytic domain P 0.001
Further Details:      
 
Domain Number 2 Region: 188-283
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.83e-21
Family Calcium ATPase, transduction domain A 0.005
Further Details:      
 
Domain Number 3 Region: 134-189,286-373
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000157
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|381335682|ref|YP_005173457.1|
Sequence length 683
Comment cation transport ATPase [Leuconostoc mesenteroides subsp. mesenteroides J18]
Sequence
MTMNHDHMNMTNKNTSHEHHDMSSMNHDHMDMSSHEHTSHAGMDSMDMSDMKRRFWWAFF
LMLPIIIITPFMGIHLPFTFTFPGSSWVSALLSTLLYFIGSKPFWDGARAEFRTKKPAMM
SLITVGLNVTFWYSIYAVLSTQLFHVHVMDFFWEFATLNVIMLLGHRIEMSVTMQAGDAT
AKLRELMPNIAHVKDDDMLMDMPIDTLKSNMIVRVLAGESFPADGTVVEGVSQVDESLMT
GESRLVEKKIGSQVVGGTINGNGTLDVKLTTVGDDSFIGQLKETLLSSQDKKSRAETLAD
KVAAWLFWVALLFAIGSLLIWTPLRGLGFAVNIAATVLVIACPHALGLAVPLVINRTKAI
AAKEGILIKNRKALVAANHLKFALMDKTGTLTTGKFTVQRFSVYDFDQSKALGIMSALDQ
QSTHPLAQSIVNYAKEQHAPKIQASHVENIAGYGVRGKIDDQLYTLASAKYLKQNHITFT
PLQTEGSISYLLEEGRVIAAIAQGDHLKESAPAFIRTLLNQGITPVMITGDNELAAKQIA
DELKITDIHSQVSPQDKINLVSEYQQHGTTMMIGDGINDAPALAQANLSIAIGVGTEVAH
ASADAILIADQLSKIIDFINLAKRSNTKQVQNLWWGASYNIIAIPLAAGVLAFAGIMLNP
MIAALIMSLSTIIVAINALLLKH
Download sequence
Identical sequences gi|381335682|ref|YP_005173457.1| WP_014324135.1.62901 WP_014324135.1.77507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]