SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472408021|ref|YP_007655126.1| from Lactobacillus brevis KB290

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472408021|ref|YP_007655126.1|
Domain Number 1 Region: 25-173,218-336,369-540,578-610
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.38e-80
Family Pyridoxal-dependent decarboxylase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472408021|ref|YP_007655126.1|
Sequence length 626
Comment L-tyrosine decarboxylase [Lactobacillus brevis KB290]
Sequence
MEKSNRSLKDLDLNALFIGDKAENGQLYKDLLNKLVDEHLGWRKNYIPSDPNMIGPEDQN
SPAFKKTVGHMKTVLDQLSERIRTESVPWHSAGRYWGHMNSETLMPALLAYNYAMLWNGN
NVAYESSPATSQMEEEVGQEFARLMGYDYGWGHIVADGSLANLEGLWYARNIKSLPFAMK
EVNPELVAGKSDWELLNMPTKEIMDLLENAGSQIDEVKKRSARSGKNLQRLGKWLVPQTK
HYSWMKAADIIGIGLDQVVPVPIDSNYRMDIQALESIIRKYAAEKTPILGVVGVAGSTEE
GAVDGIDKIVALRQKLQKEGIYFYLHVDAAYGGYARALFLDEDDQFIPYKNLQKVHAENH
VFTEDKEYIKPEVYAAYKAFDQAESITIDPHKMGYVPYSAGGIVIQDIRMRDTISYFATY
VFEKGADIPALLGAYILEGSKAGATAASVWAAHHTLPLNVTGYGKLEGASIEGAHRYYDF
LKNLKFEVAGKRISVHPLISPDFNMVDYVLKEDGNDDLIEMNRLNHAFYEQASYVKGSLY
GKEYIVSHTDFAIPDYGDSPLAFVESLGFSEVEWRHAGKVTIIRASVMTPYMNQRENFDY
FAPRIKKAIQADLEKVYASVNQKENV
Download sequence
Identical sequences A0A0A7U3J6 J7GQ11 M5B1J4 Q03NF9
gi|472408021|ref|YP_007655126.1| 387344.LVIS_2213 WP_011668784.1.1001 WP_011668784.1.10245 WP_011668784.1.12992 WP_011668784.1.14555 WP_011668784.1.30569 WP_011668784.1.33510 WP_011668784.1.35134 WP_011668784.1.41999 WP_011668784.1.56537 WP_011668784.1.61846 WP_011668784.1.6335 WP_011668784.1.67033 WP_011668784.1.68109 WP_011668784.1.79023 WP_011668784.1.80197 WP_011668784.1.86233 WP_011668784.1.92695 gi|116334767|ref|YP_796294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]