SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347548615|ref|YP_004854943.1| from Listeria ivanovii subsp. ivanovii PAM 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347548615|ref|YP_004854943.1|
Domain Number 1 Region: 292-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-44
Family ABC transporter ATPase domain-like 0.0000772
Further Details:      
 
Domain Number 2 Region: 36-286
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.18e-20
Family DNA repair protein MutS, domain III 0.009
Further Details:      
 
Domain Number 3 Region: 709-784
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000115
Family Smr domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347548615|ref|YP_004854943.1|
Sequence length 785
Comment putative MutS protein (MutS2) [Listeria ivanovii subsp. ivanovii PAM 55]
Sequence
MDKKVEAILEFDKIKKQLTEFASSSLGEQAILALTPDTDFQVVQKAQLETEEGAKIIRLR
GSAPITGLTDVNAHLKRLEIGGDLNGLEIYQIGSNLRVSRQMKNFMADLLEVGVELPLLG
ALSEELLVLNEVEEDIAISIDESGKVLDTASEALSSIRRTLRRTEDRVREKLESYLRDRN
ASKMLSDAVITIRNDRYVIPVKQEYKGHYGGIVHDQSASGQTLFIEPQSVVDLNNERKAL
QSKENQEIERVLAEISASLAGWIKEIHHNTFILGRFDFILAKARFGKAMKAVTPHLSDNG
VVRLLAARHPLLEADKVVANDIYLGEDFTTIVITGPNTGGKTITLKTLGLLTLMAQSGLQ
IPAQEDSTIAVFEHVFADIGDEQSIEQSLSTFSSHMTNIVSILANVNHQSLILYDELGAG
TDPQEGAALAISILDASHAKGASVVATTHYPELKAYGYNRVHATNASVEFNVETLSPTYK
LLIGVPGRSNAFDISRRLGLSETIITEARSLVDTESADLNDMISSLEEKRNLAESEYEEA
RELARGADALLKDLQKEISNYYQQKDKLIEQASNKAATIVEKAEAEAEEIIHELRTMQLN
GAAGIKEHELIDAKTRLGKAKPKTINKTIPQAPKQKPHVFKNGDNVRVLSLGQKGTLLNK
INDTEWNVQIGIIKMKIKTTDLEYIQPEKPKKQRIITSVHSSDSPAKSELDLRGERYEDA
LQKVDKYLDEALMAGYPQVAIIHGKGTGALRTGVTEYLKNHRMVKSIRFGAAAEGGNGVT
IVEFK
Download sequence
Identical sequences G2ZF54
gi|347548615|ref|YP_004854943.1| WP_014092624.1.18800 WP_014092624.1.77720 WP_014092624.1.92350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]