SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347549216|ref|YP_004855544.1| from Listeria ivanovii subsp. ivanovii PAM 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347549216|ref|YP_004855544.1|
Domain Number 1 Region: 7-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-83
Family Protein kinases, catalytic subunit 0.00000114
Further Details:      
 
Domain Number 2 Region: 504-564
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347549216|ref|YP_004855544.1|
Sequence length 655
Comment putative serine/threonine-specific protein kinase [Listeria ivanovii subsp. ivanovii PAM 55]
Sequence
MMIGKRLNDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKAVDIMLQIVS
AVAVAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARTQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFKADDGDTKTIPIIATKE
AMQNLDNTIVPEGKVAAEEVTEEDKKGKKKKKMSKKKKIAWIVFSVIIAFTIAILLLWML
GKGPEEIAVPDVSGKTEDQAIALLQKDGFVIGKTAEKNSDEVEEGKVINTDPDAGEMKEK
GTKVNLFVSIGSKKITMDDYTGRSYDDTKALLEEQGFKNISSEEAYSSEVDKGMIISQTP
SAGTNVVAKSTDVKFVVSKGVEPITLKDLRGYTKTAVEDYASPLGLKVSSSEENSDSVEK
GQVISQSPSSGTTMNPGDTIEIVISAGPKEKAVKEVTKTFNISYTPSDEENPEPQHIQIY
IQDKDHSMTSAYREMNISQNTSVEVTFQIEEGTSGGYKIISDDKVIDEGTVPYPN
Download sequence
Identical sequences G2ZB33
gi|347549216|ref|YP_004855544.1| WP_014093164.1.18800 WP_014093164.1.69764 WP_014093164.1.77720 WP_014093164.1.92350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]