SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386731073|ref|YP_006204569.1| from Listeria monocytogenes 07PF0776

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386731073|ref|YP_006204569.1|
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.96e-23
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386731073|ref|YP_006204569.1|
Sequence length 113
Comment hypothetical protein MUO_01700 [Listeria monocytogenes 07PF0776]
Sequence
MTDSNELTTELDSMAIILHAGNAKSCAFEALKEVKLQNIEAFTQKITEAKDEIKLAHRAH
AELLRKLSSENRMREVDLLLVHAEGHLSSTDIAVEMIRELGEIYQWKWSLSNE
Download sequence
Identical sequences A0A0E1R339 A0A0E1Y6Y6 A0A0H3GDL9 A0A1T1FG65 A0A241SLD2 A0A2G8Q984 A0A2G8QLL7 A0A2G8QNL4 A0A2G8R4F1 A0A2G8R7M2 H1GAB0 Q8YA60
gi|386042644|ref|YP_005961449.1| gi|406703083|ref|YP_006753437.1| gi|404282733|ref|YP_006683630.1| gi|550896483|ref|YP_008665979.1| gi|405754395|ref|YP_006677859.1| gi|386731073|ref|YP_006204569.1| NP_463832.1.42710 WP_003724232.1.100060 WP_003724232.1.100078 WP_003724232.1.100112 WP_003724232.1.100142 WP_003724232.1.100147 WP_003724232.1.100160 WP_003724232.1.100221 WP_003724232.1.100229 WP_003724232.1.10039 WP_003724232.1.100458 WP_003724232.1.100510 WP_003724232.1.100522 WP_003724232.1.100651 WP_003724232.1.10073 WP_003724232.1.101057 WP_003724232.1.10112 WP_003724232.1.101184 WP_003724232.1.101252 WP_003724232.1.101318 WP_003724232.1.101354 WP_003724232.1.101368 WP_003724232.1.101527 WP_003724232.1.101529 WP_003724232.1.101752 WP_003724232.1.10176 WP_003724232.1.101772 WP_003724232.1.101811 WP_003724232.1.10182 WP_003724232.1.10186 WP_003724232.1.101945 WP_003724232.1.10198 WP_003724232.1.10210 WP_003724232.1.102145 WP_003724232.1.102150 WP_003724232.1.10420 WP_003724232.1.10444 WP_003724232.1.10460 WP_003724232.1.10484 WP_003724232.1.11086 WP_003724232.1.11177 WP_003724232.1.1123 WP_003724232.1.11266 WP_003724232.1.11313 WP_003724232.1.11326 WP_003724232.1.1146 WP_003724232.1.1160 WP_003724232.1.11633 WP_003724232.1.11686 WP_003724232.1.11689 WP_003724232.1.11712 WP_003724232.1.11738 WP_003724232.1.11907 WP_003724232.1.11940 WP_003724232.1.11973 WP_003724232.1.11976 WP_003724232.1.12020 WP_003724232.1.12028 WP_003724232.1.12142 WP_003724232.1.12148 WP_003724232.1.12278 WP_003724232.1.12287 WP_003724232.1.12377 WP_003724232.1.12417 WP_003724232.1.12544 WP_003724232.1.12634 WP_003724232.1.12988 WP_003724232.1.12993 WP_003724232.1.13004 WP_003724232.1.13052 WP_003724232.1.13105 WP_003724232.1.13134 WP_003724232.1.13160 WP_003724232.1.13180 WP_003724232.1.13329 WP_003724232.1.1336 WP_003724232.1.13360 WP_003724232.1.13428 WP_003724232.1.13684 WP_003724232.1.13779 WP_003724232.1.13833 WP_003724232.1.13847 WP_003724232.1.13855 WP_003724232.1.13921 WP_003724232.1.14103 WP_003724232.1.14636 WP_003724232.1.14641 WP_003724232.1.14875 WP_003724232.1.14895 WP_003724232.1.15085 WP_003724232.1.15122 WP_003724232.1.15340 WP_003724232.1.15342 WP_003724232.1.15495 WP_003724232.1.155 WP_003724232.1.1556 WP_003724232.1.15564 WP_003724232.1.15618 WP_003724232.1.15619 WP_003724232.1.15659 WP_003724232.1.1576 WP_003724232.1.15847 WP_003724232.1.16403 WP_003724232.1.16516 WP_003724232.1.16631 WP_003724232.1.1667 WP_003724232.1.16726 WP_003724232.1.16746 WP_003724232.1.1678 WP_003724232.1.1688 WP_003724232.1.17106 WP_003724232.1.17131 WP_003724232.1.17228 WP_003724232.1.17352 WP_003724232.1.17375 WP_003724232.1.17398 WP_003724232.1.17399 WP_003724232.1.1764 WP_003724232.1.17644 WP_003724232.1.17695 WP_003724232.1.178 WP_003724232.1.1794 WP_003724232.1.17947 WP_003724232.1.18026 WP_003724232.1.1803 WP_003724232.1.18046 WP_003724232.1.18222 WP_003724232.1.18289 WP_003724232.1.18463 WP_003724232.1.18576 WP_003724232.1.18648 WP_003724232.1.18677 WP_003724232.1.18689 WP_003724232.1.18833 WP_003724232.1.18979 WP_003724232.1.19112 WP_003724232.1.19167 WP_003724232.1.19189 WP_003724232.1.19195 WP_003724232.1.19246 WP_003724232.1.19371 WP_003724232.1.19372 WP_003724232.1.19443 WP_003724232.1.19452 WP_003724232.1.19472 WP_003724232.1.19548 WP_003724232.1.19549 WP_003724232.1.19584 WP_003724232.1.19607 WP_003724232.1.19615 WP_003724232.1.19685 WP_003724232.1.197 WP_003724232.1.20263 WP_003724232.1.20378 WP_003724232.1.20402 WP_003724232.1.20416 WP_003724232.1.20548 WP_003724232.1.20672 WP_003724232.1.21046 WP_003724232.1.21099 WP_003724232.1.21133 WP_003724232.1.21371 WP_003724232.1.21428 WP_003724232.1.21429 WP_003724232.1.21527 WP_003724232.1.21542 WP_003724232.1.21567 WP_003724232.1.21597 WP_003724232.1.21705 WP_003724232.1.21706 WP_003724232.1.21711 WP_003724232.1.21874 WP_003724232.1.21889 WP_003724232.1.21926 WP_003724232.1.21995 WP_003724232.1.22188 WP_003724232.1.22190 WP_003724232.1.22194 WP_003724232.1.22202 WP_003724232.1.22221 WP_003724232.1.22383 WP_003724232.1.22468 WP_003724232.1.22597 WP_003724232.1.22656 WP_003724232.1.22776 WP_003724232.1.22962 WP_003724232.1.23060 WP_003724232.1.23139 WP_003724232.1.23254 WP_003724232.1.23255 WP_003724232.1.23291 WP_003724232.1.233 WP_003724232.1.2340 WP_003724232.1.23425 WP_003724232.1.23433 WP_003724232.1.23448 WP_003724232.1.23624 WP_003724232.1.23650 WP_003724232.1.2368 WP_003724232.1.23781 WP_003724232.1.23828 WP_003724232.1.23848 WP_003724232.1.24048 WP_003724232.1.24075 WP_003724232.1.24115 WP_003724232.1.2422 WP_003724232.1.24335 WP_003724232.1.24370 WP_003724232.1.24422 WP_003724232.1.24531 WP_003724232.1.24546 WP_003724232.1.24600 WP_003724232.1.24667 WP_003724232.1.24818 WP_003724232.1.24847 WP_003724232.1.24867 WP_003724232.1.24934 WP_003724232.1.24972 WP_003724232.1.24975 WP_003724232.1.25020 WP_003724232.1.25057 WP_003724232.1.25300 WP_003724232.1.25401 WP_003724232.1.2545 WP_003724232.1.25456 WP_003724232.1.25471 WP_003724232.1.25500 WP_003724232.1.25616 WP_003724232.1.25746 WP_003724232.1.25788 WP_003724232.1.25805 WP_003724232.1.25830 WP_003724232.1.25896 WP_003724232.1.26060 WP_003724232.1.26139 WP_003724232.1.26146 WP_003724232.1.26170 WP_003724232.1.26322 WP_003724232.1.26350 WP_003724232.1.26523 WP_003724232.1.26632 WP_003724232.1.26634 WP_003724232.1.2666 WP_003724232.1.26891 WP_003724232.1.26957 WP_003724232.1.27056 WP_003724232.1.27132 WP_003724232.1.27200 WP_003724232.1.27231 WP_003724232.1.27281 WP_003724232.1.27517 WP_003724232.1.27681 WP_003724232.1.27728 WP_003724232.1.27826 WP_003724232.1.27839 WP_003724232.1.27860 WP_003724232.1.27891 WP_003724232.1.27948 WP_003724232.1.28042 WP_003724232.1.28060 WP_003724232.1.28062 WP_003724232.1.28098 WP_003724232.1.28123 WP_003724232.1.2824 WP_003724232.1.28260 WP_003724232.1.28297 WP_003724232.1.28325 WP_003724232.1.28369 WP_003724232.1.28402 WP_003724232.1.2855 WP_003724232.1.28747 WP_003724232.1.28804 WP_003724232.1.28818 WP_003724232.1.29309 WP_003724232.1.29331 WP_003724232.1.29550 WP_003724232.1.29558 WP_003724232.1.29562 WP_003724232.1.29569 WP_003724232.1.29634 WP_003724232.1.29705 WP_003724232.1.29723 WP_003724232.1.29762 WP_003724232.1.29803 WP_003724232.1.29912 WP_003724232.1.30193 WP_003724232.1.30227 WP_003724232.1.30267 WP_003724232.1.30273 WP_003724232.1.30372 WP_003724232.1.30430 WP_003724232.1.305 WP_003724232.1.30660 WP_003724232.1.30706 WP_003724232.1.30827 WP_003724232.1.30851 WP_003724232.1.30882 WP_003724232.1.30902 WP_003724232.1.3103 WP_003724232.1.31062 WP_003724232.1.31108 WP_003724232.1.31289 WP_003724232.1.31305 WP_003724232.1.31329 WP_003724232.1.31485 WP_003724232.1.31584 WP_003724232.1.31691 WP_003724232.1.31966 WP_003724232.1.32061 WP_003724232.1.32140 WP_003724232.1.32209 WP_003724232.1.32210 WP_003724232.1.32240 WP_003724232.1.32402 WP_003724232.1.32597 WP_003724232.1.32622 WP_003724232.1.32648 WP_003724232.1.32681 WP_003724232.1.32698 WP_003724232.1.32767 WP_003724232.1.33016 WP_003724232.1.3314 WP_003724232.1.3324 WP_003724232.1.33240 WP_003724232.1.33282 WP_003724232.1.33336 WP_003724232.1.33591 WP_003724232.1.33688 WP_003724232.1.337 WP_003724232.1.33875 WP_003724232.1.3389 WP_003724232.1.3393 WP_003724232.1.34326 WP_003724232.1.34369 WP_003724232.1.34698 WP_003724232.1.34714 WP_003724232.1.34732 WP_003724232.1.34790 WP_003724232.1.34849 WP_003724232.1.34851 WP_003724232.1.34911 WP_003724232.1.3511 WP_003724232.1.35135 WP_003724232.1.35350 WP_003724232.1.35402 WP_003724232.1.35452 WP_003724232.1.35514 WP_003724232.1.35738 WP_003724232.1.36108 WP_003724232.1.36115 WP_003724232.1.3613 WP_003724232.1.36181 WP_003724232.1.36203 WP_003724232.1.36241 WP_003724232.1.364 WP_003724232.1.36599 WP_003724232.1.36749 WP_003724232.1.36877 WP_003724232.1.36936 WP_003724232.1.37023 WP_003724232.1.37426 WP_003724232.1.37466 WP_003724232.1.37471 WP_003724232.1.37518 WP_003724232.1.37561 WP_003724232.1.37665 WP_003724232.1.37723 WP_003724232.1.37882 WP_003724232.1.37900 WP_003724232.1.37927 WP_003724232.1.37951 WP_003724232.1.37986 WP_003724232.1.38015 WP_003724232.1.38076 WP_003724232.1.38150 WP_003724232.1.38281 WP_003724232.1.38302 WP_003724232.1.38396 WP_003724232.1.38424 WP_003724232.1.38471 WP_003724232.1.38528 WP_003724232.1.3853 WP_003724232.1.38575 WP_003724232.1.38733 WP_003724232.1.38741 WP_003724232.1.38792 WP_003724232.1.38800 WP_003724232.1.38819 WP_003724232.1.38833 WP_003724232.1.3892 WP_003724232.1.39000 WP_003724232.1.3919 WP_003724232.1.39218 WP_003724232.1.39262 WP_003724232.1.39307 WP_003724232.1.39316 WP_003724232.1.39348 WP_003724232.1.39351 WP_003724232.1.39427 WP_003724232.1.39496 WP_003724232.1.39552 WP_003724232.1.39554 WP_003724232.1.39630 WP_003724232.1.39794 WP_003724232.1.39887 WP_003724232.1.39895 WP_003724232.1.40124 WP_003724232.1.40263 WP_003724232.1.40420 WP_003724232.1.40504 WP_003724232.1.40556 WP_003724232.1.40580 WP_003724232.1.40720 WP_003724232.1.40953 WP_003724232.1.40976 WP_003724232.1.40978 WP_003724232.1.41222 WP_003724232.1.41337 WP_003724232.1.41603 WP_003724232.1.4166 WP_003724232.1.41876 WP_003724232.1.41955 WP_003724232.1.42040 WP_003724232.1.42089 WP_003724232.1.42127 WP_003724232.1.4218 WP_003724232.1.42310 WP_003724232.1.42317 WP_003724232.1.42525 WP_003724232.1.42550 WP_003724232.1.42672 WP_003724232.1.42958 WP_003724232.1.42994 WP_003724232.1.43060 WP_003724232.1.43135 WP_003724232.1.43267 WP_003724232.1.43280 WP_003724232.1.43304 WP_003724232.1.43327 WP_003724232.1.43336 WP_003724232.1.43350 WP_003724232.1.43458 WP_003724232.1.43480 WP_003724232.1.43619 WP_003724232.1.4371 WP_003724232.1.43768 WP_003724232.1.43807 WP_003724232.1.43916 WP_003724232.1.44092 WP_003724232.1.44106 WP_003724232.1.44147 WP_003724232.1.44161 WP_003724232.1.44230 WP_003724232.1.44427 WP_003724232.1.44645 WP_003724232.1.44663 WP_003724232.1.4472 WP_003724232.1.44749 WP_003724232.1.44806 WP_003724232.1.44897 WP_003724232.1.45295 WP_003724232.1.45355 WP_003724232.1.45512 WP_003724232.1.45524 WP_003724232.1.45541 WP_003724232.1.4557 WP_003724232.1.45708 WP_003724232.1.45719 WP_003724232.1.45758 WP_003724232.1.45759 WP_003724232.1.45778 WP_003724232.1.45803 WP_003724232.1.45811 WP_003724232.1.4587 WP_003724232.1.45877 WP_003724232.1.45883 WP_003724232.1.45893 WP_003724232.1.45983 WP_003724232.1.45994 WP_003724232.1.46045 WP_003724232.1.4615 WP_003724232.1.46154 WP_003724232.1.46180 WP_003724232.1.46277 WP_003724232.1.46314 WP_003724232.1.4642 WP_003724232.1.46456 WP_003724232.1.46566 WP_003724232.1.46711 WP_003724232.1.46725 WP_003724232.1.46834 WP_003724232.1.46867 WP_003724232.1.46883 WP_003724232.1.46981 WP_003724232.1.47001 WP_003724232.1.47075 WP_003724232.1.47203 WP_003724232.1.47384 WP_003724232.1.47412 WP_003724232.1.47431 WP_003724232.1.47518 WP_003724232.1.47520 WP_003724232.1.4753 WP_003724232.1.47593 WP_003724232.1.47650 WP_003724232.1.4766 WP_003724232.1.47738 WP_003724232.1.47953 WP_003724232.1.47979 WP_003724232.1.48007 WP_003724232.1.48161 WP_003724232.1.48163 WP_003724232.1.48175 WP_003724232.1.48235 WP_003724232.1.48358 WP_003724232.1.48410 WP_003724232.1.48435 WP_003724232.1.48440 WP_003724232.1.48471 WP_003724232.1.48565 WP_003724232.1.48572 WP_003724232.1.48624 WP_003724232.1.48661 WP_003724232.1.48854 WP_003724232.1.48999 WP_003724232.1.49 WP_003724232.1.49146 WP_003724232.1.49205 WP_003724232.1.49390 WP_003724232.1.49391 WP_003724232.1.49415 WP_003724232.1.49458 WP_003724232.1.49467 WP_003724232.1.49507 WP_003724232.1.49668 WP_003724232.1.49708 WP_003724232.1.49754 WP_003724232.1.50044 WP_003724232.1.5020 WP_003724232.1.50236 WP_003724232.1.50237 WP_003724232.1.50243 WP_003724232.1.50288 WP_003724232.1.50293 WP_003724232.1.50334 WP_003724232.1.50482 WP_003724232.1.50662 WP_003724232.1.50775 WP_003724232.1.50883 WP_003724232.1.50888 WP_003724232.1.50898 WP_003724232.1.50926 WP_003724232.1.50971 WP_003724232.1.51086 WP_003724232.1.51262 WP_003724232.1.5129 WP_003724232.1.51318 WP_003724232.1.51384 WP_003724232.1.51435 WP_003724232.1.51493 WP_003724232.1.51510 WP_003724232.1.5170 WP_003724232.1.51720 WP_003724232.1.5175 WP_003724232.1.51768 WP_003724232.1.51980 WP_003724232.1.52142 WP_003724232.1.52177 WP_003724232.1.52290 WP_003724232.1.52395 WP_003724232.1.52420 WP_003724232.1.52447 WP_003724232.1.52507 WP_003724232.1.52684 WP_003724232.1.52725 WP_003724232.1.52782 WP_003724232.1.52829 WP_003724232.1.52867 WP_003724232.1.52989 WP_003724232.1.53051 WP_003724232.1.53102 WP_003724232.1.53161 WP_003724232.1.5317 WP_003724232.1.53378 WP_003724232.1.53426 WP_003724232.1.53603 WP_003724232.1.53807 WP_003724232.1.53870 WP_003724232.1.53920 WP_003724232.1.54046 WP_003724232.1.54155 WP_003724232.1.54160 WP_003724232.1.5417 WP_003724232.1.54181 WP_003724232.1.54281 WP_003724232.1.54434 WP_003724232.1.54506 WP_003724232.1.54508 WP_003724232.1.54639 WP_003724232.1.54646 WP_003724232.1.54740 WP_003724232.1.54750 WP_003724232.1.54884 WP_003724232.1.54890 WP_003724232.1.55027 WP_003724232.1.55068 WP_003724232.1.5514 WP_003724232.1.55231 WP_003724232.1.55238 WP_003724232.1.5538 WP_003724232.1.55386 WP_003724232.1.55423 WP_003724232.1.55494 WP_003724232.1.55510 WP_003724232.1.55683 WP_003724232.1.55740 WP_003724232.1.55797 WP_003724232.1.55824 WP_003724232.1.55847 WP_003724232.1.55890 WP_003724232.1.5601 WP_003724232.1.56269 WP_003724232.1.5631 WP_003724232.1.56344 WP_003724232.1.56415 WP_003724232.1.56557 WP_003724232.1.5671 WP_003724232.1.56748 WP_003724232.1.56759 WP_003724232.1.5687 WP_003724232.1.56923 WP_003724232.1.57106 WP_003724232.1.57132 WP_003724232.1.57171 WP_003724232.1.57228 WP_003724232.1.57374 WP_003724232.1.57404 WP_003724232.1.57504 WP_003724232.1.57505 WP_003724232.1.57536 WP_003724232.1.57547 WP_003724232.1.57578 WP_003724232.1.57625 WP_003724232.1.57913 WP_003724232.1.57932 WP_003724232.1.57948 WP_003724232.1.57979 WP_003724232.1.58 WP_003724232.1.58030 WP_003724232.1.58069 WP_003724232.1.58083 WP_003724232.1.58177 WP_003724232.1.58491 WP_003724232.1.58516 WP_003724232.1.58532 WP_003724232.1.58544 WP_003724232.1.58661 WP_003724232.1.58828 WP_003724232.1.58966 WP_003724232.1.59045 WP_003724232.1.59113 WP_003724232.1.59343 WP_003724232.1.59477 WP_003724232.1.59493 WP_003724232.1.59542 WP_003724232.1.59571 WP_003724232.1.59652 WP_003724232.1.59695 WP_003724232.1.59720 WP_003724232.1.5973 WP_003724232.1.59744 WP_003724232.1.59826 WP_003724232.1.59937 WP_003724232.1.59975 WP_003724232.1.59984 WP_003724232.1.60132 WP_003724232.1.60162 WP_003724232.1.60166 WP_003724232.1.60219 WP_003724232.1.60258 WP_003724232.1.60295 WP_003724232.1.60346 WP_003724232.1.60369 WP_003724232.1.60543 WP_003724232.1.60665 WP_003724232.1.60674 WP_003724232.1.60762 WP_003724232.1.60766 WP_003724232.1.60956 WP_003724232.1.61002 WP_003724232.1.61109 WP_003724232.1.61274 WP_003724232.1.61384 WP_003724232.1.61525 WP_003724232.1.61824 WP_003724232.1.61894 WP_003724232.1.61915 WP_003724232.1.62177 WP_003724232.1.6236 WP_003724232.1.62375 WP_003724232.1.62430 WP_003724232.1.62494 WP_003724232.1.62629 WP_003724232.1.62655 WP_003724232.1.62663 WP_003724232.1.62690 WP_003724232.1.6281 WP_003724232.1.62852 WP_003724232.1.62874 WP_003724232.1.62904 WP_003724232.1.62972 WP_003724232.1.63209 WP_003724232.1.63269 WP_003724232.1.63283 WP_003724232.1.63315 WP_003724232.1.63359 WP_003724232.1.63676 WP_003724232.1.63883 WP_003724232.1.63951 WP_003724232.1.6397 WP_003724232.1.64147 WP_003724232.1.64200 WP_003724232.1.64227 WP_003724232.1.64259 WP_003724232.1.64289 WP_003724232.1.64531 WP_003724232.1.64587 WP_003724232.1.6460 WP_003724232.1.64796 WP_003724232.1.648 WP_003724232.1.64869 WP_003724232.1.64929 WP_003724232.1.65094 WP_003724232.1.65213 WP_003724232.1.65309 WP_003724232.1.65392 WP_003724232.1.65561 WP_003724232.1.65730 WP_003724232.1.65780 WP_003724232.1.6579 WP_003724232.1.65840 WP_003724232.1.65913 WP_003724232.1.66005 WP_003724232.1.66039 WP_003724232.1.66057 WP_003724232.1.66134 WP_003724232.1.66138 WP_003724232.1.66184 WP_003724232.1.66285 WP_003724232.1.66296 WP_003724232.1.66311 WP_003724232.1.66338 WP_003724232.1.66510 WP_003724232.1.66512 WP_003724232.1.66545 WP_003724232.1.66596 WP_003724232.1.6672 WP_003724232.1.66743 WP_003724232.1.66884 WP_003724232.1.66993 WP_003724232.1.67165 WP_003724232.1.67301 WP_003724232.1.6731 WP_003724232.1.67352 WP_003724232.1.67408 WP_003724232.1.6745 WP_003724232.1.67551 WP_003724232.1.67573 WP_003724232.1.67610 WP_003724232.1.6763 WP_003724232.1.67654 WP_003724232.1.67668 WP_003724232.1.67694 WP_003724232.1.67709 WP_003724232.1.67795 WP_003724232.1.67813 WP_003724232.1.67884 WP_003724232.1.67926 WP_003724232.1.68123 WP_003724232.1.68128 WP_003724232.1.68197 WP_003724232.1.68236 WP_003724232.1.68282 WP_003724232.1.68301 WP_003724232.1.68414 WP_003724232.1.68497 WP_003724232.1.68517 WP_003724232.1.68528 WP_003724232.1.69190 WP_003724232.1.69265 WP_003724232.1.69360 WP_003724232.1.69471 WP_003724232.1.69570 WP_003724232.1.69579 WP_003724232.1.69587 WP_003724232.1.69603 WP_003724232.1.69631 WP_003724232.1.69727 WP_003724232.1.69864 WP_003724232.1.6991 WP_003724232.1.70100 WP_003724232.1.70122 WP_003724232.1.7026 WP_003724232.1.70309 WP_003724232.1.70373 WP_003724232.1.7051 WP_003724232.1.70588 WP_003724232.1.70590 WP_003724232.1.70633 WP_003724232.1.70690 WP_003724232.1.70736 WP_003724232.1.70992 WP_003724232.1.71381 WP_003724232.1.71437 WP_003724232.1.71468 WP_003724232.1.71474 WP_003724232.1.7175 WP_003724232.1.71753 WP_003724232.1.71763 WP_003724232.1.71858 WP_003724232.1.71904 WP_003724232.1.71921 WP_003724232.1.72051 WP_003724232.1.72057 WP_003724232.1.72116 WP_003724232.1.7218 WP_003724232.1.72264 WP_003724232.1.72370 WP_003724232.1.72385 WP_003724232.1.72467 WP_003724232.1.72546 WP_003724232.1.72566 WP_003724232.1.72623 WP_003724232.1.72636 WP_003724232.1.72813 WP_003724232.1.72841 WP_003724232.1.72886 WP_003724232.1.73152 WP_003724232.1.73263 WP_003724232.1.73448 WP_003724232.1.73508 WP_003724232.1.73545 WP_003724232.1.73613 WP_003724232.1.74095 WP_003724232.1.74148 WP_003724232.1.7421 WP_003724232.1.74217 WP_003724232.1.74303 WP_003724232.1.74351 WP_003724232.1.74436 WP_003724232.1.74450 WP_003724232.1.74728 WP_003724232.1.74754 WP_003724232.1.74823 WP_003724232.1.74837 WP_003724232.1.74956 WP_003724232.1.7498 WP_003724232.1.7504 WP_003724232.1.75069 WP_003724232.1.75072 WP_003724232.1.75196 WP_003724232.1.75216 WP_003724232.1.75240 WP_003724232.1.7528 WP_003724232.1.7553 WP_003724232.1.75541 WP_003724232.1.75548 WP_003724232.1.75604 WP_003724232.1.7565 WP_003724232.1.75670 WP_003724232.1.75838 WP_003724232.1.75869 WP_003724232.1.75923 WP_003724232.1.76094 WP_003724232.1.76120 WP_003724232.1.76124 WP_003724232.1.76168 WP_003724232.1.76254 WP_003724232.1.76608 WP_003724232.1.76769 WP_003724232.1.76926 WP_003724232.1.76982 WP_003724232.1.77116 WP_003724232.1.77149 WP_003724232.1.77191 WP_003724232.1.77192 WP_003724232.1.77246 WP_003724232.1.77261 WP_003724232.1.77350 WP_003724232.1.7736 WP_003724232.1.7738 WP_003724232.1.77389 WP_003724232.1.77594 WP_003724232.1.77675 WP_003724232.1.77681 WP_003724232.1.77823 WP_003724232.1.77849 WP_003724232.1.77943 WP_003724232.1.78088 WP_003724232.1.78121 WP_003724232.1.78130 WP_003724232.1.78167 WP_003724232.1.78203 WP_003724232.1.7832 WP_003724232.1.78328 WP_003724232.1.78336 WP_003724232.1.78525 WP_003724232.1.78717 WP_003724232.1.79149 WP_003724232.1.79184 WP_003724232.1.79212 WP_003724232.1.79259 WP_003724232.1.79295 WP_003724232.1.7932 WP_003724232.1.79602 WP_003724232.1.79630 WP_003724232.1.79803 WP_003724232.1.79821 WP_003724232.1.79964 WP_003724232.1.80028 WP_003724232.1.80036 WP_003724232.1.80088 WP_003724232.1.80514 WP_003724232.1.80693 WP_003724232.1.80790 WP_003724232.1.80968 WP_003724232.1.81140 WP_003724232.1.81261 WP_003724232.1.81270 WP_003724232.1.81315 WP_003724232.1.81503 WP_003724232.1.8151 WP_003724232.1.81647 WP_003724232.1.81662 WP_003724232.1.81713 WP_003724232.1.81833 WP_003724232.1.81863 WP_003724232.1.82274 WP_003724232.1.82294 WP_003724232.1.82372 WP_003724232.1.82440 WP_003724232.1.82480 WP_003724232.1.82605 WP_003724232.1.82616 WP_003724232.1.82667 WP_003724232.1.82719 WP_003724232.1.82951 WP_003724232.1.82974 WP_003724232.1.83015 WP_003724232.1.83130 WP_003724232.1.83137 WP_003724232.1.83215 WP_003724232.1.83217 WP_003724232.1.83260 WP_003724232.1.83323 WP_003724232.1.83542 WP_003724232.1.83546 WP_003724232.1.83755 WP_003724232.1.83877 WP_003724232.1.8391 WP_003724232.1.8418 WP_003724232.1.84265 WP_003724232.1.84320 WP_003724232.1.84367 WP_003724232.1.84539 WP_003724232.1.84579 WP_003724232.1.84586 WP_003724232.1.84588 WP_003724232.1.8460 WP_003724232.1.8465 WP_003724232.1.8473 WP_003724232.1.84781 WP_003724232.1.84833 WP_003724232.1.84895 WP_003724232.1.84974 WP_003724232.1.85037 WP_003724232.1.85172 WP_003724232.1.85194 WP_003724232.1.85203 WP_003724232.1.85317 WP_003724232.1.85321 WP_003724232.1.8539 WP_003724232.1.85576 WP_003724232.1.85887 WP_003724232.1.85890 WP_003724232.1.86056 WP_003724232.1.86091 WP_003724232.1.86253 WP_003724232.1.86484 WP_003724232.1.86571 WP_003724232.1.86597 WP_003724232.1.866 WP_003724232.1.86752 WP_003724232.1.86958 WP_003724232.1.87085 WP_003724232.1.8710 WP_003724232.1.87101 WP_003724232.1.87108 WP_003724232.1.8715 WP_003724232.1.87179 WP_003724232.1.87294 WP_003724232.1.87328 WP_003724232.1.87329 WP_003724232.1.87436 WP_003724232.1.87536 WP_003724232.1.87537 WP_003724232.1.8782 WP_003724232.1.87890 WP_003724232.1.87903 WP_003724232.1.88015 WP_003724232.1.88055 WP_003724232.1.88063 WP_003724232.1.88128 WP_003724232.1.88211 WP_003724232.1.88422 WP_003724232.1.88463 WP_003724232.1.88485 WP_003724232.1.88584 WP_003724232.1.88639 WP_003724232.1.88768 WP_003724232.1.88783 WP_003724232.1.88800 WP_003724232.1.88806 WP_003724232.1.8884 WP_003724232.1.88877 WP_003724232.1.88890 WP_003724232.1.88895 WP_003724232.1.88974 WP_003724232.1.89014 WP_003724232.1.89085 WP_003724232.1.89160 WP_003724232.1.89267 WP_003724232.1.89302 WP_003724232.1.8932 WP_003724232.1.89386 WP_003724232.1.89387 WP_003724232.1.89443 WP_003724232.1.89450 WP_003724232.1.89478 WP_003724232.1.89756 WP_003724232.1.89812 WP_003724232.1.8988 WP_003724232.1.89897 WP_003724232.1.89969 WP_003724232.1.90086 WP_003724232.1.9019 WP_003724232.1.90212 WP_003724232.1.90326 WP_003724232.1.90459 WP_003724232.1.90524 WP_003724232.1.90567 WP_003724232.1.90645 WP_003724232.1.90646 WP_003724232.1.90741 WP_003724232.1.90772 WP_003724232.1.90821 WP_003724232.1.90829 WP_003724232.1.90857 WP_003724232.1.90963 WP_003724232.1.91084 WP_003724232.1.9109 WP_003724232.1.91140 WP_003724232.1.91168 WP_003724232.1.91195 WP_003724232.1.91212 WP_003724232.1.91556 WP_003724232.1.91920 WP_003724232.1.92049 WP_003724232.1.92132 WP_003724232.1.92142 WP_003724232.1.92274 WP_003724232.1.92288 WP_003724232.1.92370 WP_003724232.1.92409 WP_003724232.1.9243 WP_003724232.1.92548 WP_003724232.1.92595 WP_003724232.1.9282 WP_003724232.1.92928 WP_003724232.1.92963 WP_003724232.1.93014 WP_003724232.1.93049 WP_003724232.1.93217 WP_003724232.1.93325 WP_003724232.1.93421 WP_003724232.1.93490 WP_003724232.1.93534 WP_003724232.1.93556 WP_003724232.1.93558 WP_003724232.1.93611 WP_003724232.1.93712 WP_003724232.1.93777 WP_003724232.1.93859 WP_003724232.1.93867 WP_003724232.1.93895 WP_003724232.1.93920 WP_003724232.1.93997 WP_003724232.1.94026 WP_003724232.1.94032 WP_003724232.1.94058 WP_003724232.1.94081 WP_003724232.1.94191 WP_003724232.1.94206 WP_003724232.1.94225 WP_003724232.1.94233 WP_003724232.1.94401 WP_003724232.1.94431 WP_003724232.1.94447 WP_003724232.1.94464 WP_003724232.1.94499 WP_003724232.1.94537 WP_003724232.1.94554 WP_003724232.1.94613 WP_003724232.1.9470 WP_003724232.1.94758 WP_003724232.1.94759 WP_003724232.1.94906 WP_003724232.1.94961 WP_003724232.1.9502 WP_003724232.1.9505 WP_003724232.1.95100 WP_003724232.1.95146 WP_003724232.1.95162 WP_003724232.1.9517 WP_003724232.1.95186 WP_003724232.1.95197 WP_003724232.1.95256 WP_003724232.1.95696 WP_003724232.1.95715 WP_003724232.1.95945 WP_003724232.1.96033 WP_003724232.1.96084 WP_003724232.1.96156 WP_003724232.1.96296 WP_003724232.1.96407 WP_003724232.1.96422 WP_003724232.1.9643 WP_003724232.1.96438 WP_003724232.1.96449 WP_003724232.1.96542 WP_003724232.1.96544 WP_003724232.1.96586 WP_003724232.1.96596 WP_003724232.1.96605 WP_003724232.1.96708 WP_003724232.1.9672 WP_003724232.1.96751 WP_003724232.1.96835 WP_003724232.1.96867 WP_003724232.1.96940 WP_003724232.1.97140 WP_003724232.1.97165 WP_003724232.1.97199 WP_003724232.1.97257 WP_003724232.1.9732 WP_003724232.1.97378 WP_003724232.1.97390 WP_003724232.1.97469 WP_003724232.1.97569 WP_003724232.1.97587 WP_003724232.1.97589 WP_003724232.1.97633 WP_003724232.1.9768 WP_003724232.1.9769 WP_003724232.1.97752 WP_003724232.1.97803 WP_003724232.1.97820 WP_003724232.1.97900 WP_003724232.1.97970 WP_003724232.1.9802 WP_003724232.1.98038 WP_003724232.1.98042 WP_003724232.1.98060 WP_003724232.1.98193 WP_003724232.1.98351 WP_003724232.1.98689 WP_003724232.1.98826 WP_003724232.1.98829 WP_003724232.1.9894 WP_003724232.1.99026 WP_003724232.1.9916 WP_003724232.1.99199 WP_003724232.1.99409 WP_003724232.1.99512 WP_003724232.1.99520 WP_003724232.1.99521 WP_003724232.1.99527 WP_003724232.1.99553 WP_003724232.1.99568 WP_003724232.1.99663 WP_003724232.1.99702 WP_003724232.1.99737 WP_003724232.1.99785 WP_003724232.1.99786 WP_003724232.1.99818 WP_003724232.1.99836 WP_003724232.1.99906 WP_003724232.1.99914 WP_003724232.1.99921 WP_003724232.1.99974 gi|16802347|ref|NP_463832.1| gi|404406763|ref|YP_006689478.1| gi|386052582|ref|YP_005970140.1| gi|386049230|ref|YP_005967221.1| gi|405751527|ref|YP_006674992.1| gi|284800600|ref|YP_003412465.1| gi|284993786|ref|YP_003415554.1| gi|404279864|ref|YP_006680762.1| gi|405757289|ref|YP_006686565.1| gi|525721901|ref|YP_008286401.1| gi|424713175|ref|YP_007013890.1| gi|404409546|ref|YP_006695134.1| gi|404285680|ref|YP_006692266.1| 169963.lmo0301 265669.LMOf2365_0322 634178.Lm4b_00329 gi|226222937|ref|YP_002757044.1| gi|46906543|ref|YP_012932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]