SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386731629|ref|YP_006205125.1| from Listeria monocytogenes 07PF0776

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386731629|ref|YP_006205125.1|
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.75e-30
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386731629|ref|YP_006205125.1|
Sequence length 109
Comment PTS system enzyme IIA component [Listeria monocytogenes 07PF0776]
Sequence
MDIEKISFSLISLAGDSFSKLIEALHAAKESDSELVEQLLKEADDLMIEAHKVQTEMLIQ
ETRGEQANFSVLLVHAQDTLMNTILASTLIREMIEMHQEIKTLRKEEEK
Download sequence
Identical sequences A0A241SNC6 A0A2A5ZSF9
gi|226223493|ref|YP_002757600.1| gi|404280425|ref|YP_006681323.1| 634178.Lm4b_00892 gi|406703649|ref|YP_006754003.1| gi|386731629|ref|YP_006205125.1| gi|404286283|ref|YP_006692869.1| WP_003730898.1.100142 WP_003730898.1.100221 WP_003730898.1.10039 WP_003730898.1.101318 WP_003730898.1.101529 WP_003730898.1.10176 WP_003730898.1.102145 WP_003730898.1.10444 WP_003730898.1.12028 WP_003730898.1.12142 WP_003730898.1.12148 WP_003730898.1.12278 WP_003730898.1.12544 WP_003730898.1.13329 WP_003730898.1.13847 WP_003730898.1.14636 WP_003730898.1.14832 WP_003730898.1.14895 WP_003730898.1.15085 WP_003730898.1.155 WP_003730898.1.15619 WP_003730898.1.15847 WP_003730898.1.16631 WP_003730898.1.18677 WP_003730898.1.18833 WP_003730898.1.1929 WP_003730898.1.19549 WP_003730898.1.19615 WP_003730898.1.197 WP_003730898.1.20378 WP_003730898.1.20548 WP_003730898.1.21429 WP_003730898.1.21889 WP_003730898.1.22194 WP_003730898.1.22468 WP_003730898.1.22597 WP_003730898.1.23139 WP_003730898.1.23255 WP_003730898.1.23433 WP_003730898.1.23448 WP_003730898.1.24115 WP_003730898.1.24335 WP_003730898.1.24531 WP_003730898.1.24667 WP_003730898.1.24867 WP_003730898.1.2545 WP_003730898.1.25471 WP_003730898.1.25500 WP_003730898.1.25746 WP_003730898.1.25805 WP_003730898.1.26170 WP_003730898.1.26634 WP_003730898.1.27056 WP_003730898.1.27517 WP_003730898.1.27826 WP_003730898.1.28098 WP_003730898.1.2824 WP_003730898.1.28260 WP_003730898.1.28369 WP_003730898.1.2855 WP_003730898.1.28722 WP_003730898.1.28792 WP_003730898.1.29309 WP_003730898.1.29803 WP_003730898.1.30372 WP_003730898.1.3103 WP_003730898.1.31289 WP_003730898.1.31691 WP_003730898.1.32648 WP_003730898.1.33591 WP_003730898.1.34911 WP_003730898.1.35514 WP_003730898.1.37471 WP_003730898.1.37665 WP_003730898.1.37927 WP_003730898.1.38015 WP_003730898.1.38302 WP_003730898.1.38528 WP_003730898.1.39307 WP_003730898.1.39316 WP_003730898.1.39427 WP_003730898.1.40580 WP_003730898.1.40978 WP_003730898.1.41876 WP_003730898.1.42040 WP_003730898.1.42550 WP_003730898.1.43336 WP_003730898.1.43458 WP_003730898.1.43480 WP_003730898.1.44161 WP_003730898.1.44427 WP_003730898.1.44663 WP_003730898.1.4472 WP_003730898.1.45355 WP_003730898.1.45719 WP_003730898.1.46180 WP_003730898.1.4642 WP_003730898.1.46725 WP_003730898.1.46981 WP_003730898.1.47384 WP_003730898.1.47518 WP_003730898.1.47520 WP_003730898.1.47650 WP_003730898.1.48410 WP_003730898.1.48565 WP_003730898.1.49 WP_003730898.1.49391 WP_003730898.1.49708 WP_003730898.1.50044 WP_003730898.1.50293 WP_003730898.1.50662 WP_003730898.1.50765 WP_003730898.1.50775 WP_003730898.1.51086 WP_003730898.1.51262 WP_003730898.1.51384 WP_003730898.1.5170 WP_003730898.1.51768 WP_003730898.1.51980 WP_003730898.1.52142 WP_003730898.1.52507 WP_003730898.1.53051 WP_003730898.1.53603 WP_003730898.1.53870 WP_003730898.1.54281 WP_003730898.1.54434 WP_003730898.1.54740 WP_003730898.1.5538 WP_003730898.1.55609 WP_003730898.1.56322 WP_003730898.1.56344 WP_003730898.1.56748 WP_003730898.1.5687 WP_003730898.1.57932 WP_003730898.1.58 WP_003730898.1.58516 WP_003730898.1.59652 WP_003730898.1.59695 WP_003730898.1.60162 WP_003730898.1.61384 WP_003730898.1.61824 WP_003730898.1.62573 WP_003730898.1.62874 WP_003730898.1.63269 WP_003730898.1.63283 WP_003730898.1.63883 WP_003730898.1.64289 WP_003730898.1.64413 WP_003730898.1.65392 WP_003730898.1.66134 WP_003730898.1.66545 WP_003730898.1.6745 WP_003730898.1.67813 WP_003730898.1.68128 WP_003730898.1.68497 WP_003730898.1.68740 WP_003730898.1.69864 WP_003730898.1.70373 WP_003730898.1.72370 WP_003730898.1.72886 WP_003730898.1.73545 WP_003730898.1.74095 WP_003730898.1.7421 WP_003730898.1.75072 WP_003730898.1.75196 WP_003730898.1.75548 WP_003730898.1.75923 WP_003730898.1.76094 WP_003730898.1.76608 WP_003730898.1.77191 WP_003730898.1.78130 WP_003730898.1.79259 WP_003730898.1.79602 WP_003730898.1.80514 WP_003730898.1.81647 WP_003730898.1.81863 WP_003730898.1.82372 WP_003730898.1.82662 WP_003730898.1.83217 WP_003730898.1.85321 WP_003730898.1.86056 WP_003730898.1.86752 WP_003730898.1.87101 WP_003730898.1.87328 WP_003730898.1.87537 WP_003730898.1.87890 WP_003730898.1.87903 WP_003730898.1.88768 WP_003730898.1.88806 WP_003730898.1.89267 WP_003730898.1.89897 WP_003730898.1.89969 WP_003730898.1.90212 WP_003730898.1.90459 WP_003730898.1.90741 WP_003730898.1.91140 WP_003730898.1.91195 WP_003730898.1.92963 WP_003730898.1.93014 WP_003730898.1.93049 WP_003730898.1.93325 WP_003730898.1.94206 WP_003730898.1.94431 WP_003730898.1.94447 WP_003730898.1.94537 WP_003730898.1.94613 WP_003730898.1.9470 WP_003730898.1.94795 WP_003730898.1.94906 WP_003730898.1.9502 WP_003730898.1.95100 WP_003730898.1.95146 WP_003730898.1.9517 WP_003730898.1.96156 WP_003730898.1.96438 WP_003730898.1.96596 WP_003730898.1.96867 WP_003730898.1.97569 WP_003730898.1.97589 WP_003730898.1.97900 WP_003730898.1.97970 WP_003730898.1.98689 WP_003730898.1.98826 WP_003730898.1.99553 WP_003730898.1.99568 WP_003730898.1.99702 WP_003730898.1.99836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]