SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386732458|ref|YP_006205954.1| from Listeria monocytogenes 07PF0776

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386732458|ref|YP_006205954.1|
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.7e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386732458|ref|YP_006205954.1|
Sequence length 100
Comment phosphotransferase system (PTS) lichenan-specific enzyme IIA component [Listeria monocytogenes 07PF0776]
Sequence
MELEQTIMQLIVHGGNAKSDAMLAIEAAKKRDFDAADEQIKSAEAALLEAHHSQTSLIQG
EARGEKAEVSLLLVHAQDHLMNAITFKDLAKEIVDLYRSK
Download sequence
Identical sequences gi|386732458|ref|YP_006205954.1| WP_014654278.1.94431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]