SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386733483|ref|YP_006206979.1| from Listeria monocytogenes 07PF0776

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386733483|ref|YP_006206979.1|
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.71e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386733483|ref|YP_006206979.1|
Sequence length 102
Comment cellobiose PTS enzyme IIA [Listeria monocytogenes 07PF0776]
Sequence
MEGMELASFQIISSVGAARSCIIEAMKFGRQRKFTEAYKKIDEANEFLSEGHKNHVQLIQ
KEADGGDVQISILFMHAEDQFMTTYTLRDVAYEMIAIWKEMK
Download sequence
Identical sequences A0A0B8R902 A0A0E0V0Z1 A0A0E1XYX1 A0A241SUN1
265669.LMOf2365_2771 552536.LMHCC_2742 634178.Lm4b_02756 gi|217966013|ref|YP_002351691.1| gi|386733483|ref|YP_006206979.1| gi|404288169|ref|YP_006694755.1| gi|525735039|ref|YP_008291018.1| gi|226225333|ref|YP_002759440.1| gi|405756912|ref|YP_006680376.1| gi|525722200|ref|YP_008286773.1| gi|405754002|ref|YP_006677467.1| gi|404409163|ref|YP_006691878.1| gi|386028187|ref|YP_005948963.1| gi|46908970|ref|YP_015359.1| gi|406705523|ref|YP_006755877.1| gi|404282356|ref|YP_006683254.1| gi|386009561|ref|YP_005927839.1| gi|405751129|ref|YP_006674595.1| WP_003725330.1.100060 WP_003725330.1.100078 WP_003725330.1.100142 WP_003725330.1.100160 WP_003725330.1.100221 WP_003725330.1.100261 WP_003725330.1.10039 WP_003725330.1.100458 WP_003725330.1.100522 WP_003725330.1.100651 WP_003725330.1.10073 WP_003725330.1.100835 WP_003725330.1.101057 WP_003725330.1.101318 WP_003725330.1.101527 WP_003725330.1.101529 WP_003725330.1.101688 WP_003725330.1.10176 WP_003725330.1.101772 WP_003725330.1.101811 WP_003725330.1.10182 WP_003725330.1.10210 WP_003725330.1.102145 WP_003725330.1.102150 WP_003725330.1.10418 WP_003725330.1.10444 WP_003725330.1.10460 WP_003725330.1.11086 WP_003725330.1.1146 WP_003725330.1.1160 WP_003725330.1.11633 WP_003725330.1.11689 WP_003725330.1.11788 WP_003725330.1.12020 WP_003725330.1.12028 WP_003725330.1.12142 WP_003725330.1.12148 WP_003725330.1.12278 WP_003725330.1.12287 WP_003725330.1.12417 WP_003725330.1.12544 WP_003725330.1.12634 WP_003725330.1.12993 WP_003725330.1.13004 WP_003725330.1.13180 WP_003725330.1.13234 WP_003725330.1.13329 WP_003725330.1.13360 WP_003725330.1.13684 WP_003725330.1.13779 WP_003725330.1.13847 WP_003725330.1.13855 WP_003725330.1.13921 WP_003725330.1.14029 WP_003725330.1.14072 WP_003725330.1.14103 WP_003725330.1.14339 WP_003725330.1.14636 WP_003725330.1.14641 WP_003725330.1.14832 WP_003725330.1.14875 WP_003725330.1.14895 WP_003725330.1.15085 WP_003725330.1.15122 WP_003725330.1.15340 WP_003725330.1.15342 WP_003725330.1.15495 WP_003725330.1.155 WP_003725330.1.15518 WP_003725330.1.15564 WP_003725330.1.15618 WP_003725330.1.15619 WP_003725330.1.15659 WP_003725330.1.1575 WP_003725330.1.15847 WP_003725330.1.16403 WP_003725330.1.16516 WP_003725330.1.16631 WP_003725330.1.1667 WP_003725330.1.16726 WP_003725330.1.16746 WP_003725330.1.1678 WP_003725330.1.1688 WP_003725330.1.17106 WP_003725330.1.17131 WP_003725330.1.17398 WP_003725330.1.17399 WP_003725330.1.17774 WP_003725330.1.18026 WP_003725330.1.18046 WP_003725330.1.18289 WP_003725330.1.18463 WP_003725330.1.18677 WP_003725330.1.18721 WP_003725330.1.18833 WP_003725330.1.18979 WP_003725330.1.19112 WP_003725330.1.19167 WP_003725330.1.19195 WP_003725330.1.19246 WP_003725330.1.1929 WP_003725330.1.19372 WP_003725330.1.19443 WP_003725330.1.19452 WP_003725330.1.19472 WP_003725330.1.19542 WP_003725330.1.19549 WP_003725330.1.19584 WP_003725330.1.19607 WP_003725330.1.19615 WP_003725330.1.19626 WP_003725330.1.19685 WP_003725330.1.197 WP_003725330.1.19901 WP_003725330.1.20263 WP_003725330.1.20378 WP_003725330.1.20548 WP_003725330.1.20672 WP_003725330.1.21099 WP_003725330.1.21338 WP_003725330.1.21371 WP_003725330.1.21428 WP_003725330.1.21429 WP_003725330.1.21527 WP_003725330.1.21529 WP_003725330.1.21542 WP_003725330.1.21567 WP_003725330.1.21597 WP_003725330.1.21706 WP_003725330.1.21711 WP_003725330.1.21874 WP_003725330.1.21889 WP_003725330.1.22099 WP_003725330.1.22188 WP_003725330.1.22194 WP_003725330.1.22221 WP_003725330.1.22383 WP_003725330.1.22468 WP_003725330.1.22597 WP_003725330.1.22776 WP_003725330.1.23060 WP_003725330.1.23139 WP_003725330.1.23255 WP_003725330.1.23291 WP_003725330.1.233 WP_003725330.1.23419 WP_003725330.1.23425 WP_003725330.1.23433 WP_003725330.1.23448 WP_003725330.1.23650 WP_003725330.1.23781 WP_003725330.1.23828 WP_003725330.1.23848 WP_003725330.1.24048 WP_003725330.1.24075 WP_003725330.1.24115 WP_003725330.1.24335 WP_003725330.1.24411 WP_003725330.1.24422 WP_003725330.1.24531 WP_003725330.1.24600 WP_003725330.1.24667 WP_003725330.1.24847 WP_003725330.1.24867 WP_003725330.1.24934 WP_003725330.1.24975 WP_003725330.1.25300 WP_003725330.1.2545 WP_003725330.1.25456 WP_003725330.1.25471 WP_003725330.1.25500 WP_003725330.1.25616 WP_003725330.1.25746 WP_003725330.1.25788 WP_003725330.1.25805 WP_003725330.1.25830 WP_003725330.1.25896 WP_003725330.1.26138 WP_003725330.1.26166 WP_003725330.1.26170 WP_003725330.1.26322 WP_003725330.1.2662 WP_003725330.1.26634 WP_003725330.1.2666 WP_003725330.1.26957 WP_003725330.1.27056 WP_003725330.1.27132 WP_003725330.1.27143 WP_003725330.1.27517 WP_003725330.1.27669 WP_003725330.1.27681 WP_003725330.1.27728 WP_003725330.1.27826 WP_003725330.1.27860 WP_003725330.1.27891 WP_003725330.1.27948 WP_003725330.1.28060 WP_003725330.1.28076 WP_003725330.1.28098 WP_003725330.1.2824 WP_003725330.1.28260 WP_003725330.1.2832 WP_003725330.1.28369 WP_003725330.1.2855 WP_003725330.1.28722 WP_003725330.1.28792 WP_003725330.1.28804 WP_003725330.1.28818 WP_003725330.1.29138 WP_003725330.1.29309 WP_003725330.1.29558 WP_003725330.1.29562 WP_003725330.1.29565 WP_003725330.1.29569 WP_003725330.1.29634 WP_003725330.1.29803 WP_003725330.1.30124 WP_003725330.1.30273 WP_003725330.1.30372 WP_003725330.1.30430 WP_003725330.1.30660 WP_003725330.1.30706 WP_003725330.1.30837 WP_003725330.1.30851 WP_003725330.1.3103 WP_003725330.1.31062 WP_003725330.1.31289 WP_003725330.1.31305 WP_003725330.1.31329 WP_003725330.1.31691 WP_003725330.1.31966 WP_003725330.1.3206 WP_003725330.1.32061 WP_003725330.1.32140 WP_003725330.1.32240 WP_003725330.1.32597 WP_003725330.1.32648 WP_003725330.1.32681 WP_003725330.1.32698 WP_003725330.1.32767 WP_003725330.1.32817 WP_003725330.1.33016 WP_003725330.1.33039 WP_003725330.1.3314 WP_003725330.1.33240 WP_003725330.1.33282 WP_003725330.1.33591 WP_003725330.1.3389 WP_003725330.1.3393 WP_003725330.1.34369 WP_003725330.1.34698 WP_003725330.1.34714 WP_003725330.1.34790 WP_003725330.1.34911 WP_003725330.1.3511 WP_003725330.1.35350 WP_003725330.1.35452 WP_003725330.1.35514 WP_003725330.1.35738 WP_003725330.1.35979 WP_003725330.1.36108 WP_003725330.1.36115 WP_003725330.1.3613 WP_003725330.1.36582 WP_003725330.1.36749 WP_003725330.1.37023 WP_003725330.1.37426 WP_003725330.1.37466 WP_003725330.1.37471 WP_003725330.1.37665 WP_003725330.1.37723 WP_003725330.1.37900 WP_003725330.1.37927 WP_003725330.1.37951 WP_003725330.1.37986 WP_003725330.1.38015 WP_003725330.1.38281 WP_003725330.1.38302 WP_003725330.1.38382 WP_003725330.1.38396 WP_003725330.1.384 WP_003725330.1.38424 WP_003725330.1.38528 WP_003725330.1.38575 WP_003725330.1.38741 WP_003725330.1.38819 WP_003725330.1.3892 WP_003725330.1.39000 WP_003725330.1.39218 WP_003725330.1.39220 WP_003725330.1.39307 WP_003725330.1.39316 WP_003725330.1.39348 WP_003725330.1.39427 WP_003725330.1.39496 WP_003725330.1.39552 WP_003725330.1.39794 WP_003725330.1.39871 WP_003725330.1.39895 WP_003725330.1.40245 WP_003725330.1.404 WP_003725330.1.40420 WP_003725330.1.40504 WP_003725330.1.40556 WP_003725330.1.40580 WP_003725330.1.40841 WP_003725330.1.40978 WP_003725330.1.41023 WP_003725330.1.41222 WP_003725330.1.41337 WP_003725330.1.41603 WP_003725330.1.4166 WP_003725330.1.41700 WP_003725330.1.41876 WP_003725330.1.41970 WP_003725330.1.42040 WP_003725330.1.42089 WP_003725330.1.42310 WP_003725330.1.42317 WP_003725330.1.42339 WP_003725330.1.42525 WP_003725330.1.42550 WP_003725330.1.42564 WP_003725330.1.42616 WP_003725330.1.42926 WP_003725330.1.42994 WP_003725330.1.43060 WP_003725330.1.43135 WP_003725330.1.43304 WP_003725330.1.43336 WP_003725330.1.43350 WP_003725330.1.43458 WP_003725330.1.43480 WP_003725330.1.43768 WP_003725330.1.43807 WP_003725330.1.43916 WP_003725330.1.44092 WP_003725330.1.44147 WP_003725330.1.44161 WP_003725330.1.44230 WP_003725330.1.44427 WP_003725330.1.44596 WP_003725330.1.44663 WP_003725330.1.44703 WP_003725330.1.4472 WP_003725330.1.44749 WP_003725330.1.44806 WP_003725330.1.4503 WP_003725330.1.4510 WP_003725330.1.45355 WP_003725330.1.45512 WP_003725330.1.45541 WP_003725330.1.4557 WP_003725330.1.4562 WP_003725330.1.45719 WP_003725330.1.45759 WP_003725330.1.45778 WP_003725330.1.4578 WP_003725330.1.45803 WP_003725330.1.4587 WP_003725330.1.45883 WP_003725330.1.45893 WP_003725330.1.46064 WP_003725330.1.46154 WP_003725330.1.46180 WP_003725330.1.46277 WP_003725330.1.4642 WP_003725330.1.46425 WP_003725330.1.46456 WP_003725330.1.46566 WP_003725330.1.46711 WP_003725330.1.46725 WP_003725330.1.46834 WP_003725330.1.46867 WP_003725330.1.46981 WP_003725330.1.47001 WP_003725330.1.47075 WP_003725330.1.47203 WP_003725330.1.47384 WP_003725330.1.47431 WP_003725330.1.47518 WP_003725330.1.47520 WP_003725330.1.4753 WP_003725330.1.47650 WP_003725330.1.47759 WP_003725330.1.47952 WP_003725330.1.47979 WP_003725330.1.48007 WP_003725330.1.48161 WP_003725330.1.48163 WP_003725330.1.48175 WP_003725330.1.48235 WP_003725330.1.48410 WP_003725330.1.48440 WP_003725330.1.48441 WP_003725330.1.48565 WP_003725330.1.48854 WP_003725330.1.49 WP_003725330.1.49390 WP_003725330.1.49391 WP_003725330.1.49458 WP_003725330.1.49507 WP_003725330.1.49708 WP_003725330.1.4974 WP_003725330.1.49754 WP_003725330.1.50044 WP_003725330.1.50073 WP_003725330.1.50288 WP_003725330.1.50293 WP_003725330.1.50482 WP_003725330.1.50662 WP_003725330.1.50765 WP_003725330.1.50775 WP_003725330.1.50862 WP_003725330.1.5099 WP_003725330.1.51086 WP_003725330.1.51262 WP_003725330.1.51384 WP_003725330.1.51493 WP_003725330.1.5170 WP_003725330.1.51768 WP_003725330.1.51980 WP_003725330.1.52142 WP_003725330.1.52290 WP_003725330.1.52371 WP_003725330.1.52420 WP_003725330.1.52507 WP_003725330.1.52725 WP_003725330.1.52782 WP_003725330.1.52829 WP_003725330.1.53051 WP_003725330.1.53193 WP_003725330.1.53426 WP_003725330.1.53536 WP_003725330.1.53566 WP_003725330.1.53603 WP_003725330.1.53870 WP_003725330.1.53877 WP_003725330.1.54281 WP_003725330.1.54434 WP_003725330.1.54505 WP_003725330.1.54506 WP_003725330.1.54508 WP_003725330.1.5472 WP_003725330.1.54740 WP_003725330.1.54750 WP_003725330.1.54884 WP_003725330.1.55027 WP_003725330.1.55068 WP_003725330.1.5514 WP_003725330.1.5538 WP_003725330.1.55386 WP_003725330.1.55423 WP_003725330.1.55494 WP_003725330.1.55510 WP_003725330.1.55609 WP_003725330.1.55850 WP_003725330.1.5631 WP_003725330.1.56322 WP_003725330.1.56344 WP_003725330.1.56566 WP_003725330.1.5671 WP_003725330.1.56748 WP_003725330.1.5687 WP_003725330.1.57106 WP_003725330.1.57228 WP_003725330.1.57374 WP_003725330.1.57536 WP_003725330.1.57913 WP_003725330.1.57932 WP_003725330.1.58 WP_003725330.1.58083 WP_003725330.1.58491 WP_003725330.1.58516 WP_003725330.1.58966 WP_003725330.1.59113 WP_003725330.1.59353 WP_003725330.1.59493 WP_003725330.1.59542 WP_003725330.1.59652 WP_003725330.1.59695 WP_003725330.1.59720 WP_003725330.1.59744 WP_003725330.1.59826 WP_003725330.1.59975 WP_003725330.1.60132 WP_003725330.1.60162 WP_003725330.1.60295 WP_003725330.1.60297 WP_003725330.1.60543 WP_003725330.1.60674 WP_003725330.1.60762 WP_003725330.1.60766 WP_003725330.1.60768 WP_003725330.1.61072 WP_003725330.1.611 WP_003725330.1.61274 WP_003725330.1.61371 WP_003725330.1.61384 WP_003725330.1.61525 WP_003725330.1.61824 WP_003725330.1.61915 WP_003725330.1.6236 WP_003725330.1.62375 WP_003725330.1.62494 WP_003725330.1.62573 WP_003725330.1.62690 WP_003725330.1.6281 WP_003725330.1.62874 WP_003725330.1.63209 WP_003725330.1.63269 WP_003725330.1.63283 WP_003725330.1.63315 WP_003725330.1.63605 WP_003725330.1.63842 WP_003725330.1.63883 WP_003725330.1.64147 WP_003725330.1.64289 WP_003725330.1.64413 WP_003725330.1.64531 WP_003725330.1.64587 WP_003725330.1.64796 WP_003725330.1.64869 WP_003725330.1.64929 WP_003725330.1.65143 WP_003725330.1.65392 WP_003725330.1.65561 WP_003725330.1.65780 WP_003725330.1.66057 WP_003725330.1.66134 WP_003725330.1.66138 WP_003725330.1.66285 WP_003725330.1.66296 WP_003725330.1.66510 WP_003725330.1.66545 WP_003725330.1.66596 WP_003725330.1.66743 WP_003725330.1.66993 WP_003725330.1.6745 WP_003725330.1.67551 WP_003725330.1.67573 WP_003725330.1.67654 WP_003725330.1.67813 WP_003725330.1.67926 WP_003725330.1.68128 WP_003725330.1.68208 WP_003725330.1.68236 WP_003725330.1.68282 WP_003725330.1.68497 WP_003725330.1.68517 WP_003725330.1.68525 WP_003725330.1.68740 WP_003725330.1.69263 WP_003725330.1.69360 WP_003725330.1.69587 WP_003725330.1.69603 WP_003725330.1.69864 WP_003725330.1.6991 WP_003725330.1.69989 WP_003725330.1.70100 WP_003725330.1.70122 WP_003725330.1.7026 WP_003725330.1.7031 WP_003725330.1.70373 WP_003725330.1.70590 WP_003725330.1.70633 WP_003725330.1.70736 WP_003725330.1.71381 WP_003725330.1.71437 WP_003725330.1.71474 WP_003725330.1.71585 WP_003725330.1.71726 WP_003725330.1.7175 WP_003725330.1.71763 WP_003725330.1.71858 WP_003725330.1.71904 WP_003725330.1.72264 WP_003725330.1.72370 WP_003725330.1.72546 WP_003725330.1.72623 WP_003725330.1.72813 WP_003725330.1.72886 WP_003725330.1.72918 WP_003725330.1.73152 WP_003725330.1.73222 WP_003725330.1.73263 WP_003725330.1.73448 WP_003725330.1.73508 WP_003725330.1.73545 WP_003725330.1.73613 WP_003725330.1.74095 WP_003725330.1.74148 WP_003725330.1.7421 WP_003725330.1.74303 WP_003725330.1.74436 WP_003725330.1.74728 WP_003725330.1.74823 WP_003725330.1.74927 WP_003725330.1.74956 WP_003725330.1.75019 WP_003725330.1.7504 WP_003725330.1.75072 WP_003725330.1.75196 WP_003725330.1.75216 WP_003725330.1.7528 WP_003725330.1.7553 WP_003725330.1.75548 WP_003725330.1.7565 WP_003725330.1.75838 WP_003725330.1.75869 WP_003725330.1.75923 WP_003725330.1.76094 WP_003725330.1.76168 WP_003725330.1.76247 WP_003725330.1.76254 WP_003725330.1.76367 WP_003725330.1.76545 WP_003725330.1.76608 WP_003725330.1.76926 WP_003725330.1.76982 WP_003725330.1.7718 WP_003725330.1.77191 WP_003725330.1.77222 WP_003725330.1.77261 WP_003725330.1.77345 WP_003725330.1.7738 WP_003725330.1.77389 WP_003725330.1.77594 WP_003725330.1.77675 WP_003725330.1.77697 WP_003725330.1.77849 WP_003725330.1.77928 WP_003725330.1.77943 WP_003725330.1.78088 WP_003725330.1.78130 WP_003725330.1.78315 WP_003725330.1.78328 WP_003725330.1.78681 WP_003725330.1.78717 WP_003725330.1.79128 WP_003725330.1.79149 WP_003725330.1.79259 WP_003725330.1.79295 WP_003725330.1.79602 WP_003725330.1.79821 WP_003725330.1.79962 WP_003725330.1.80088 WP_003725330.1.80514 WP_003725330.1.80693 WP_003725330.1.80968 WP_003725330.1.81140 WP_003725330.1.81270 WP_003725330.1.81315 WP_003725330.1.81476 WP_003725330.1.81495 WP_003725330.1.8151 WP_003725330.1.81647 WP_003725330.1.81693 WP_003725330.1.81725 WP_003725330.1.81833 WP_003725330.1.81863 WP_003725330.1.82294 WP_003725330.1.82372 WP_003725330.1.82480 WP_003725330.1.82605 WP_003725330.1.82616 WP_003725330.1.82662 WP_003725330.1.82821 WP_003725330.1.82974 WP_003725330.1.83015 WP_003725330.1.83130 WP_003725330.1.83217 WP_003725330.1.83236 WP_003725330.1.83755 WP_003725330.1.83809 WP_003725330.1.83877 WP_003725330.1.83907 WP_003725330.1.8391 WP_003725330.1.84180 WP_003725330.1.8465 WP_003725330.1.84895 WP_003725330.1.84974 WP_003725330.1.85036 WP_003725330.1.85172 WP_003725330.1.85194 WP_003725330.1.85317 WP_003725330.1.85321 WP_003725330.1.8539 WP_003725330.1.85576 WP_003725330.1.85690 WP_003725330.1.85887 WP_003725330.1.85890 WP_003725330.1.86056 WP_003725330.1.86098 WP_003725330.1.86232 WP_003725330.1.86279 WP_003725330.1.86571 WP_003725330.1.86683 WP_003725330.1.86752 WP_003725330.1.87101 WP_003725330.1.8715 WP_003725330.1.87179 WP_003725330.1.87294 WP_003725330.1.87328 WP_003725330.1.87329 WP_003725330.1.87436 WP_003725330.1.87537 WP_003725330.1.87890 WP_003725330.1.87903 WP_003725330.1.88055 WP_003725330.1.88211 WP_003725330.1.88397 WP_003725330.1.88422 WP_003725330.1.88463 WP_003725330.1.88639 WP_003725330.1.88768 WP_003725330.1.88783 WP_003725330.1.88800 WP_003725330.1.88806 WP_003725330.1.88877 WP_003725330.1.88895 WP_003725330.1.88974 WP_003725330.1.89014 WP_003725330.1.89127 WP_003725330.1.89267 WP_003725330.1.89302 WP_003725330.1.89387 WP_003725330.1.89505 WP_003725330.1.89756 WP_003725330.1.89812 WP_003725330.1.89897 WP_003725330.1.89916 WP_003725330.1.89969 WP_003725330.1.90135 WP_003725330.1.90212 WP_003725330.1.90326 WP_003725330.1.90459 WP_003725330.1.90524 WP_003725330.1.90646 WP_003725330.1.90741 WP_003725330.1.90772 WP_003725330.1.90857 WP_003725330.1.90963 WP_003725330.1.91084 WP_003725330.1.91140 WP_003725330.1.91168 WP_003725330.1.91195 WP_003725330.1.91212 WP_003725330.1.91443 WP_003725330.1.91560 WP_003725330.1.91920 WP_003725330.1.91922 WP_003725330.1.92288 WP_003725330.1.9243 WP_003725330.1.92494 WP_003725330.1.92591 WP_003725330.1.9282 WP_003725330.1.92928 WP_003725330.1.92963 WP_003725330.1.93014 WP_003725330.1.93049 WP_003725330.1.93217 WP_003725330.1.93325 WP_003725330.1.93421 WP_003725330.1.93490 WP_003725330.1.93534 WP_003725330.1.93558 WP_003725330.1.93611 WP_003725330.1.93712 WP_003725330.1.93867 WP_003725330.1.94026 WP_003725330.1.94059 WP_003725330.1.94081 WP_003725330.1.94206 WP_003725330.1.94225 WP_003725330.1.94233 WP_003725330.1.94336 WP_003725330.1.94401 WP_003725330.1.94431 WP_003725330.1.94447 WP_003725330.1.94464 WP_003725330.1.94499 WP_003725330.1.94537 WP_003725330.1.94554 WP_003725330.1.94613 WP_003725330.1.9470 WP_003725330.1.94759 WP_003725330.1.94795 WP_003725330.1.94906 WP_003725330.1.9502 WP_003725330.1.9505 WP_003725330.1.95100 WP_003725330.1.95146 WP_003725330.1.9517 WP_003725330.1.95197 WP_003725330.1.95256 WP_003725330.1.95696 WP_003725330.1.96084 WP_003725330.1.96156 WP_003725330.1.96422 WP_003725330.1.96438 WP_003725330.1.96449 WP_003725330.1.96496 WP_003725330.1.96542 WP_003725330.1.96544 WP_003725330.1.96596 WP_003725330.1.96605 WP_003725330.1.96708 WP_003725330.1.96751 WP_003725330.1.96835 WP_003725330.1.96867 WP_003725330.1.97140 WP_003725330.1.97257 WP_003725330.1.97315 WP_003725330.1.97378 WP_003725330.1.97469 WP_003725330.1.97569 WP_003725330.1.97587 WP_003725330.1.97589 WP_003725330.1.9768 WP_003725330.1.9769 WP_003725330.1.97803 WP_003725330.1.97900 WP_003725330.1.97970 WP_003725330.1.9802 WP_003725330.1.98375 WP_003725330.1.98490 WP_003725330.1.98689 WP_003725330.1.98826 WP_003725330.1.98829 WP_003725330.1.98974 WP_003725330.1.99199 WP_003725330.1.99518 WP_003725330.1.99553 WP_003725330.1.99568 WP_003725330.1.99663 WP_003725330.1.99702 WP_003725330.1.99737 WP_003725330.1.99818 WP_003725330.1.99836 WP_003725330.1.99906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]