SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|558683213|ref|YP_008821342.1| from Bacillus thuringiensis YBT-1518

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|558683213|ref|YP_008821342.1|
Domain Number 1 Region: 338-567
Classification Level Classification E-value
Superfamily PHP domain-like 9.29e-57
Family PHP domain 0.001
Further Details:      
 
Domain Number 2 Region: 154-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.81e-46
Family DNA polymerase beta-like 0.0035
Further Details:      
 
Domain Number 3 Region: 2-79
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.19e-20
Family DNA polymerase beta, N-terminal domain-like 0.003
Further Details:      
 
Domain Number 4 Region: 48-145
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000000178
Family Achaeal helicase C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|558683213|ref|YP_008821342.1|
Sequence length 572
Comment hypothetical protein YBT1518_25185 [Bacillus thuringiensis YBT-1518]
Sequence
MKVNKKQVIKLLETIGLFMELKGANPFKISAFRKAAAALESDDRSLSEIEDFTKIPGIGK
GTAAVIQEYIESGTSEVLQELEKEVPSSLLPLLKLPGLGGKKVAKLYKELGVVDMESLKA
VCEENKVQALAGFGKKTEEKILEAIDQVGSRPERLPIAMVLPIAGEIEEKLSNIAEVIRF
SRAGSLRRVRETVKDLDFIIATTEPAAVREHLLQFDNMIEVIASGDTKVSVRLQYEYDIS
IDFRLVKPEEFITTLHHFTGSKDHNVKMRQIAKDKGEKISEYGVENLETGEVKTFETEED
FFAHFGLPFIPPEVREDGKEIELIKEYPNLIQFSDIQGDLHMHTTWSDGAFSIEEMVQAC
RARGYKFMAITDHSQYLKVANGLTKERLREQAKEIERMNEKYPDITILRGIEMDILPDAS
LDFDDEVLEELDYVIGAIHSSFSQDRETIMKRLRTALENKHVTMIAHPTGRLLGRREGYD
VDTDLLIELAKETNTVLELNANPNRLDLSAKLLKQAQDAGVKVAINTDAHTLEMLEDMET
GVAAARKGWIQKDNVINTWDIERLLDYIKRNK
Download sequence
Identical sequences A0A0D0QMJ9 A0A0D0RCH5 A0A150DHT8 A0A1B1LCJ8 A0A1I4EWD6 A0A1M7FKV4 A0A243ENX1 A0A2A2P1S4 A0A2A9HN98 J8QE37 J9C029 R8E394 R8FC72 R8G3U1 R8GAP2 R8K0X5 S3IN17 V5MGE2
WP_000867533.1.11521 WP_000867533.1.13975 WP_000867533.1.17797 WP_000867533.1.22152 WP_000867533.1.23245 WP_000867533.1.26826 WP_000867533.1.3249 WP_000867533.1.34061 WP_000867533.1.34125 WP_000867533.1.3925 WP_000867533.1.40818 WP_000867533.1.41090 WP_000867533.1.41729 WP_000867533.1.4447 WP_000867533.1.54547 WP_000867533.1.60255 WP_000867533.1.69347 WP_000867533.1.72752 WP_000867533.1.75891 WP_000867533.1.77402 WP_000867533.1.79549 WP_000867533.1.84775 WP_000867533.1.85667 WP_000867533.1.91367 WP_000867533.1.93838 WP_000867533.1.94914 WP_000867533.1.9533 WP_000867533.1.96272 gi|558683213|ref|YP_008821342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]