SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407647324|ref|YP_006811083.1| from Nocardia brasiliensis ATCC 700358

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407647324|ref|YP_006811083.1|
Domain Number 1 Region: 42-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.31e-51
Family Phosphate binding protein-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407647324|ref|YP_006811083.1|
Sequence length 357
Comment 2-aminoethylphosphonate ABC transporter substrate-binding protein [Nocardia brasiliensis ATCC 700358]
Sequence
MRTSNTQTRLARRLSRAALLVAAVTTVAATAACGGTGTDSASGKTVTVYSADGVGSWYQN
QFAEFKKQTGIAVNLVEAGSGEVVNRVDKEQANPQADVVVTLPPFIQKAKAAGLLQDSGV
DTSAVPAADKDAEGKYVTLANNYLCFIANPAVDAKALTWDDLLKPEFKGKLQYSTPGQAG
DGTAVLILLQKLLGKQGALDYLAKLQANNVGPSSSTGKLQAKVDKGELSIANGDVQMNLT
TIKEKSSKFSVFFPATADGKKSTVAVPYVMGLAKGAPHQADAKKLMEFLLSAQAQKSLGT
DAFAVPARAELRETPAAGSGPSPSSVLQGVELLPVDWNKVLTDLDADLAAYQKATGS
Download sequence
Identical sequences K0F3J7
gi|407647324|ref|YP_006811083.1| WP_014986964.1.58666 WP_014986964.1.73442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]