SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407647689|ref|YP_006811448.1| from Nocardia brasiliensis ATCC 700358

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407647689|ref|YP_006811448.1|
Domain Number 1 Region: 38-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.9e-53
Family Phosphate binding protein-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407647689|ref|YP_006811448.1|
Sequence length 259
Comment molybdate transporter subunit, periplasmic-binding component of ABC superfamily protein [Nocardia brasiliensis ATCC 700358]
Sequence
MIRSLSSAAVAGVIALSLAGCGSDDKAAPADGSGIGGTVTVFAAASLTETFTALGKQFEA
AHPGVKVVYSFGASSALAEQINQGAPADVFASAAPKNMQQVKDKGEVTVAPVTFVRNRLE
IAVPKGNPGHITGLADFGKTEPKLALCAEQVPCGAAAKTVFEAAGVTPQPDTREADVKAV
LTKVKLGEVDAALVYRTDVRAAGDQVAGIDFAESGKAINDYPVAPLAHAPNAAAAAAFVE
FVQSPQARAVFTEAGFDNP
Download sequence
Identical sequences K0F4F9
gi|407647689|ref|YP_006811448.1| WP_014987325.1.58666 WP_014987325.1.73442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]