SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407649014|ref|YP_006812773.1| from Nocardia brasiliensis ATCC 700358

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407649014|ref|YP_006812773.1|
Domain Number 1 Region: 63-286
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-23
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407649014|ref|YP_006812773.1|
Sequence length 364
Comment ABC transporter substrate-binding protein [Nocardia brasiliensis ATCC 700358]
Sequence
MTPAQRSSFGPALNRRSLLRYSALAGAALGGAGLLTACGDNAADPSGGSTPDGSKYGTVA
VQLSWLKNIEFAGEYFADSKGYFKEAGFGSVNLIAGGAASTSVEAGLDTGKIWLGLSAPQ
TTAKAVLEGLPAKIIATTYQKNPFAIVSSAAKPIKTPADMKGRKIGVQDTNQLIFNALLT
ANGLKPGDVTIVPAQFDPTPLANGEVDGWVSYVTNEPITLTAKGFANTHFLFADYNLPLV
AETLTVKQATIDKERDKLKAFLVAEIKGWRDAVANPAESARLAVEVYGKDQKLDLDEQTK
EAVAQNDLVVSADTAANGLLSMTDKLIEQNIAALRLADLDIKADQLFDLSVLREVFAENP
GLKG
Download sequence
Identical sequences K0F7V6
gi|407649014|ref|YP_006812773.1| WP_014988646.1.58666 WP_014988646.1.73442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]