SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333933560|ref|YP_004507138.1| from Serratia plymuthica AS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333933560|ref|YP_004507138.1|
Domain Number 1 Region: 83-210
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-25
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.18e-20
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333933560|ref|YP_004507138.1|
Sequence length 228
Comment GntR family transcriptional regulator [Serratia plymuthica AS9]
Sequence
MSESYSLTNTLPVNQQIYRFLRKDIVDCTIPPGTLLSEKEISTRFSVSRQPVREAFIKLA
EAGLVQILPQRGTFVMKISAKRVADGRFIRQAVECAIVRRVAQRITPEQLMTLEHNLHRQ
ELAAQNQQTREFLALDDEFHQLLTQFADCPLAWETIETIKATMDRVRFLSLSEVSPPESL
IQQHYRIFAALKAQDADAAERAIHEHLQEMIYSITPIALQNTEWFDIE
Download sequence
Identical sequences S4YLJ4
WP_006327242.1.100617 WP_006327242.1.16783 WP_006327242.1.20703 WP_006327242.1.22336 WP_006327242.1.28294 WP_006327242.1.51785 WP_006327242.1.55341 WP_006327242.1.61654 WP_006327242.1.72308 WP_006327242.1.85867 WP_006327242.1.87098 WP_006327242.1.95373 gi|333933560|ref|YP_004507138.1| gi|333928607|ref|YP_004502186.1| gi|521169366|ref|YP_008160562.1| gi|386330430|ref|YP_006026600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]