SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333933896|ref|YP_004507474.1| from Serratia plymuthica AS9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333933896|ref|YP_004507474.1|
Domain Number 1 Region: 88-222
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.54e-28
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 17-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000244
Family GntR-like transcriptional regulators 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333933896|ref|YP_004507474.1|
Sequence length 225
Comment GntR family transcriptional regulator [Serratia plymuthica AS9]
Sequence
MTVDAESQTLPTAEEAGLSLNELAYRRFKQALVTLSYKPGEYLNTAQVMSELDMGRTPIN
QAIHRLANEGLLQVIPRKGVMVSPLSMDDALELIEVRLANEMLCMRLASKRITEPQIAAL
TALNQQIEAACQSRDRIRMMTLDHAFHQELALIAGNNMLADILSVLHARAQRFWASTLSR
EGHMREVIEEHRAIIAALAAQDSDAAADAAEAHILSFRSALLHEG
Download sequence
Identical sequences gi|386330766|ref|YP_006026936.1| gi|333928943|ref|YP_004502522.1| gi|333933896|ref|YP_004507474.1| WP_013814388.1.100617 WP_013814388.1.28294 WP_013814388.1.87098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]