SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386028154|ref|YP_005948930.1| from Listeria monocytogenes M7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386028154|ref|YP_005948930.1|
Domain Number 1 Region: 436-658
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00000105
Family Tricorn protease N-terminal domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|386028154|ref|YP_005948930.1|
Domain Number - Region: 25-168,196-287
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000173
Family DPP6 N-terminal domain-like 0.049
Further Details:      
 
Domain Number - Region: 1853-1969
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000955
Family Apolipoprotein A-I 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386028154|ref|YP_005948930.1|
Sequence length 2222
Comment hypothetical protein LMM7_2867 [Listeria monocytogenes M7]
Sequence
MNKNGAREFEIVDSKTGKISLFAANGLLLKVTSKDGNATNYTYNADGELVKMITGSGKIL
QYTWDADGHLKEIVLPDGGKLAYSYDDDGNLTKLVDQTGKAITYQYDSEHHMTSYKDHNG
KLLIKNTFDADGRVTEQTDGEGNTATLKYEKGKTTTTDFNGNKKVVYFNERFQTTKTEYA
DDTTTENKYGDKHQLVASIDQLGNTTTFENDANGNLTKTVYPDGTTETNEFDAKNQLIRV
TDSRGGVTSYTYDSKGNVVQITEPNGGVKKFTHNADGQVVTETDANGAVTKTAYDAKGNP
TKVTDGRGNETTYAYDNLSMLSSITDANGKSEKYERNARGELVREWNANGAATKYSYDSN
GNKTSETDENGNSTTFEYDAFGRLSEETNPLGGVTKYKYDGNGNKISETDPLGNTEEFKY
DSQNRMIEAIAADGSVITYRYDALGQKLSEETEDGQKTSYLYDAKSGYKTQETDPLGNKT
SYAYDADGNVTKITYPDETTEEFSYDAMDNITRFVDQAGNVQTYEFDANGNTTKLKEAGR
VSTYSYDENGSVTSEQDAAGGVKRYSFDKVDQVEIETDELGEKTHYVYDADGNVTKITDG
NGHTITMAYDNAGNVIRQTDAEGNTTKYTYNALHLVETEISPTNDITQYRYNKNGDLIKE
IDPYNNETSYRYTKTGEVSKIIDALGNETTYDYDNRGNLTTSTDPLGRKTTYSYDKADRV
IEQKNPDGTKATYTYDKMDRLLEQQDNTGQKESYKYNATGDVTRVADRKGRTESYTYDTF
GNVSSKTDMRGNKTSYEYDAANRLVKQQNPTGKAQSIDYNKRGDITSEVLPNTGKYTYNY
DAEGNLLSETNPLGETTSYQYNGNDELITTTNPAGAKSSVTYDANGNVTAVTDENGGITK
QTFDATGLITSQTDAEGNKTQFGYDQLGRLTTEIDAAGFKLLNSYDAAGRLITETDKRGN
TTKYTYDNADNILTVKEPYGTTSTFKYDLRGNVTKEIDAKGNATTYSYDKDDQLLSETDP
IGYKQSYKYNEYGDLIEESDNQQKKAIASYTYDKLGQQTTKKDIQGRITRYTYDDTQRMT
QITYPNKLAVGYTYDKLDRVTTMRDVRGNDTKIQYDKVGNVTSMIDPGNQVYKYTYDKKG
NMTKEIDPLAASTEYRYNKNDQVISIKDPTNAITKYQYDARNLLTSITDAKGHTTKMAYD
GNENLSETTDAKGNKERFEYDALDRMTAAQNRLGQKSTYTYDKVDNVTEIKDAKGFVTKY
SYNDRSDLVKEVTPEGKTEKYEYQLDGSLKSKTKPDGEKTTFKYDELNNLVEQQFDGGSY
KYTYDSNDDVKTATSKDGTSKFTYNKFGDVLSVKDANGETLKYEYDTIGRKTALIYPDNT
RVSYRYNDANLLTDVIESDGKKTSYTYDANGLPLSIHYSNGTTTSYKYTATGETEQVITK
NKAGETIASFDYNYDENGNVAKETINQSGEKQTKSHTYDADDQLMETTITKGKTTEKITY
IYDANGNRSKLLRNKNGKKTTENYHYDDDNALTMIKADGDKDTTYTYDKNGNITKKALRS
GKVETYTYNGENQLIQSADNEGNQTTYTYDAFGNRIGKQTITDKTKSFKGSLSEWITEYD
KDSQKGKTETLAAQLETRANETSKGCSAYAEASTQKVTKDGMQGKTELKGSDSSGSKTSQ
RTTKMTQTVGYQTVNTIRYVNDLTQEYTQVAQLNETTEDDGETSTTKTAFRFGDDNQIIG
TEEESYHENGLTDITTTTDGETSTDYDYTDYGTALATAPVANQIGYRAQMHDTSDTQNLR
ARNYDTNTGRFQQVDSYRGSLDDPRSQNRYIYGVNNPMSFGDPSGNIPKWLKKATKKVKK
AAKKVSKGIKKAKKVIKKTVKKVKRAVKKVKKAIKKTTKKIKRAVKKVTKKVQKTVTKFK
KAAKKSIKQARKTVKKVYKKAKQTVVKKVNKIKKTTKKVVKTVKKAGTKVINKATSKIKT
VGKKANAIIAAGKEAAAKAKKEKADRKAAAKEALCKNQEFLESQKKGYSDPTYDYKAGYP
RPDEAWAFDANGNIDKEKSAEVSEKIGEWSTYALMLVIPGPEELLITGILVKVGGKVGPK
IISWGANKFGAKGAAKTATKEASEIIIPKATDLKNSNTVQKHIEEIVKKGANKGQLSRPY
IDTDGTTLLLDEIMNAASPVKDRVLSNGLRWDVEGVFRNSKGTWELVVDMSTNTIVHFNF
VN
Download sequence
Identical sequences A0A0E0UZK4
gi|386028154|ref|YP_005948930.1| gi|217966046|ref|YP_002351724.1| 552536.LMHCC_2776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]