SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386007367|ref|YP_005925645.1| from Listeria monocytogenes L99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386007367|ref|YP_005925645.1|
Domain Number 1 Region: 318-337,414-616
Classification Level Classification E-value
Superfamily HAD-like 6.46e-54
Family Meta-cation ATPase, catalytic domain P 0.00083
Further Details:      
 
Domain Number 2 Region: 124-218
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.18e-23
Family Calcium ATPase, transduction domain A 0.008
Further Details:      
 
Domain Number 3 Region: 69-121,219-305
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000157
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386007367|ref|YP_005925645.1|
Sequence length 626
Comment heavy metal-transporting ATPase [Listeria monocytogenes L99]
Sequence
MKEWMKQNWQFITTGISGILIVIGCLVGSEVGDFWTAVIFLSAFVIGGFEQAKEGIQATI
QTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYTTNKSKREITKLMAFQP
ERAFRLLPNGDLEEVAAKELQLDDMLFVRPGESVPIDGVIVRGSTTLNEAAINGESVPAT
KTVGADVFGGTVNVSSAITVKVTQTFDNTIFSKIIRLVESAQSEPSKTARFIERFEDAYV
KAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCALVASVTPATLAAISNGARHG
ILFKGGVHLENLRGVKAVAFDKTGTLTNGTPELTDRLFAENVDKQQVINVVGAMERQSLH
PLAAAITQDLEAEITEKLTEIEVTDVPGWGVQAVYREAIWQVGKAGFVGNEEARVFSNGA
FERLAGEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTIKALQAKGIKTIMVTGDNEQTGA
AIQAELGMDYVVSGCLPEKKVDVLKELSVTYGSVAMVGDGINDAPALAHAAVGIAMGEGT
DIAMETADVVLMKNDLEKIPYAYNLSERLHWITWQNICFAIAVILVLITANVFQLINLPF
GVVGHEGSTILVILNGLRLLRSNRKK
Download sequence
Identical sequences A0A0E0UUN9
WP_012581807.1.33039 WP_012581807.1.53566 WP_012581807.1.5472 WP_012581807.1.90135 WP_012581807.1.98375 552536.LMHCC_1992 gi|386007367|ref|YP_005925645.1| gi|217965267|ref|YP_002350945.1| gi|386025957|ref|YP_005946733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]