SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386007765|ref|YP_005926043.1| from Listeria monocytogenes L99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386007765|ref|YP_005926043.1|
Domain Number 1 Region: 30-252
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.53e-59
Family Phosphate binding protein-like 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386007765|ref|YP_005926043.1|
Sequence length 256
Comment molybdenum ABC transporter molybdenum-binding protein [Listeria monocytogenes L99]
Sequence
MKKIMLFISFGLLLLLGACGDSPEEVKQTTIHISAAASLKDTMDEVIPLFEKANPTIKLS
FDFGGSGQIRERVESGAPIDGVLLASKKDVDTLSKQNLAENTKEFAGNDLVLIAPKNADQ
QTEANLEQLLDNASKIAIGDPESVPAGAYAKQTLENVNLYNAEKAKLVLATDVRQVLSYV
EAGNADAGFVYQTDALLSKKVQVKAKIDEKLHDPIGYYSAQVSDSDKKEETAAFLDFMNK
SEAQKILEKYGFKAAN
Download sequence
Identical sequences A0A0E0UUN5
WP_012581589.1.33039 WP_012581589.1.53566 WP_012581589.1.5472 WP_012581589.1.90135 WP_012581589.1.98375 gi|386007765|ref|YP_005926043.1| 552536.LMHCC_1587 gi|386026358|ref|YP_005947134.1| gi|217964866|ref|YP_002350544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]