SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386008508|ref|YP_005926786.1| from Listeria monocytogenes L99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386008508|ref|YP_005926786.1|
Domain Number 1 Region: 1-266
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.13e-66
Family Phosphate binding protein-like 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386008508|ref|YP_005926786.1|
Sequence length 271
Comment amino acid ABC transporter substrate-binding protein [Listeria monocytogenes L99]
Sequence
MKKGLLITVMLMVMLALGACSSGESKEDQWSRIKKDKEVVIGLDDSFVPMGFRDKDDNLV
GFDIDLAKAVFAEYGIKAKFTPIDWTMKESELKNGSIDLIWNGYTVTDARKKQVAFSQPY
MKNEQVLVTLKSSNINQFSDMKNKTLGAQNGASSIDDMAKKPEVLTDIINNNEPELYDTF
DTAFIDLNNKRIDGLIIDEVYARYYIDKQKNKDDYNIITGGFDATDFAVGMRKSDKELQT
KINEAFEKLYKEGKMQEISKKWFGDDEIAKQ
Download sequence
Identical sequences A0A0B8RH73 A0A0E0UXY0 A0A0E1R734 A0A0E1YCY3 A0A241SQR3
WP_003728238.1.100078 WP_003728238.1.100142 WP_003728238.1.100160 WP_003728238.1.100221 WP_003728238.1.10039 WP_003728238.1.100458 WP_003728238.1.100651 WP_003728238.1.10073 WP_003728238.1.101057 WP_003728238.1.101318 WP_003728238.1.101527 WP_003728238.1.101529 WP_003728238.1.10176 WP_003728238.1.101772 WP_003728238.1.10182 WP_003728238.1.10210 WP_003728238.1.102145 WP_003728238.1.102150 WP_003728238.1.10444 WP_003728238.1.11086 WP_003728238.1.1146 WP_003728238.1.1160 WP_003728238.1.11689 WP_003728238.1.12020 WP_003728238.1.12142 WP_003728238.1.12148 WP_003728238.1.12278 WP_003728238.1.12417 WP_003728238.1.12544 WP_003728238.1.12634 WP_003728238.1.12993 WP_003728238.1.13004 WP_003728238.1.13360 WP_003728238.1.13684 WP_003728238.1.13779 WP_003728238.1.13847 WP_003728238.1.13855 WP_003728238.1.13921 WP_003728238.1.14103 WP_003728238.1.14636 WP_003728238.1.14832 WP_003728238.1.14875 WP_003728238.1.14895 WP_003728238.1.15085 WP_003728238.1.15122 WP_003728238.1.15340 WP_003728238.1.15342 WP_003728238.1.155 WP_003728238.1.15619 WP_003728238.1.15659 WP_003728238.1.15847 WP_003728238.1.16403 WP_003728238.1.16516 WP_003728238.1.16631 WP_003728238.1.1667 WP_003728238.1.16726 WP_003728238.1.1678 WP_003728238.1.1688 WP_003728238.1.17106 WP_003728238.1.17398 WP_003728238.1.18026 WP_003728238.1.18046 WP_003728238.1.18289 WP_003728238.1.18463 WP_003728238.1.18677 WP_003728238.1.18833 WP_003728238.1.19112 WP_003728238.1.19246 WP_003728238.1.19443 WP_003728238.1.19452 WP_003728238.1.19472 WP_003728238.1.19549 WP_003728238.1.19584 WP_003728238.1.19607 WP_003728238.1.19615 WP_003728238.1.19685 WP_003728238.1.197 WP_003728238.1.20263 WP_003728238.1.20378 WP_003728238.1.20548 WP_003728238.1.20672 WP_003728238.1.21099 WP_003728238.1.21429 WP_003728238.1.21527 WP_003728238.1.21542 WP_003728238.1.21597 WP_003728238.1.21706 WP_003728238.1.21711 WP_003728238.1.21874 WP_003728238.1.21889 WP_003728238.1.22188 WP_003728238.1.22194 WP_003728238.1.22221 WP_003728238.1.22468 WP_003728238.1.22597 WP_003728238.1.22776 WP_003728238.1.23060 WP_003728238.1.23139 WP_003728238.1.23255 WP_003728238.1.233 WP_003728238.1.23425 WP_003728238.1.23433 WP_003728238.1.23448 WP_003728238.1.23650 WP_003728238.1.23781 WP_003728238.1.23828 WP_003728238.1.23848 WP_003728238.1.24075 WP_003728238.1.24115 WP_003728238.1.24335 WP_003728238.1.24422 WP_003728238.1.24531 WP_003728238.1.24600 WP_003728238.1.24667 WP_003728238.1.24847 WP_003728238.1.24867 WP_003728238.1.24934 WP_003728238.1.25300 WP_003728238.1.2545 WP_003728238.1.25471 WP_003728238.1.25500 WP_003728238.1.25746 WP_003728238.1.25805 WP_003728238.1.25830 WP_003728238.1.25896 WP_003728238.1.26166 WP_003728238.1.26170 WP_003728238.1.26322 WP_003728238.1.2662 WP_003728238.1.26634 WP_003728238.1.2666 WP_003728238.1.26957 WP_003728238.1.27056 WP_003728238.1.27132 WP_003728238.1.27517 WP_003728238.1.27681 WP_003728238.1.27728 WP_003728238.1.27826 WP_003728238.1.27860 WP_003728238.1.27891 WP_003728238.1.28060 WP_003728238.1.28098 WP_003728238.1.2824 WP_003728238.1.28260 WP_003728238.1.2832 WP_003728238.1.28369 WP_003728238.1.2855 WP_003728238.1.28722 WP_003728238.1.28792 WP_003728238.1.28804 WP_003728238.1.28818 WP_003728238.1.29309 WP_003728238.1.29558 WP_003728238.1.29562 WP_003728238.1.29569 WP_003728238.1.29634 WP_003728238.1.29803 WP_003728238.1.30372 WP_003728238.1.30430 WP_003728238.1.30706 WP_003728238.1.3103 WP_003728238.1.31062 WP_003728238.1.31289 WP_003728238.1.31305 WP_003728238.1.31329 WP_003728238.1.32061 WP_003728238.1.32140 WP_003728238.1.32597 WP_003728238.1.32648 WP_003728238.1.32681 WP_003728238.1.32698 WP_003728238.1.32767 WP_003728238.1.33016 WP_003728238.1.33039 WP_003728238.1.33282 WP_003728238.1.33591 WP_003728238.1.3389 WP_003728238.1.3393 WP_003728238.1.34698 WP_003728238.1.34714 WP_003728238.1.34911 WP_003728238.1.35350 WP_003728238.1.35452 WP_003728238.1.35514 WP_003728238.1.36108 WP_003728238.1.3613 WP_003728238.1.36749 WP_003728238.1.37426 WP_003728238.1.37466 WP_003728238.1.37471 WP_003728238.1.37665 WP_003728238.1.37723 WP_003728238.1.37900 WP_003728238.1.37927 WP_003728238.1.37951 WP_003728238.1.37986 WP_003728238.1.38015 WP_003728238.1.38302 WP_003728238.1.38424 WP_003728238.1.38528 WP_003728238.1.38741 WP_003728238.1.38819 WP_003728238.1.3892 WP_003728238.1.39218 WP_003728238.1.39307 WP_003728238.1.39316 WP_003728238.1.39348 WP_003728238.1.39427 WP_003728238.1.39496 WP_003728238.1.39895 WP_003728238.1.40420 WP_003728238.1.40504 WP_003728238.1.40556 WP_003728238.1.40580 WP_003728238.1.40978 WP_003728238.1.41222 WP_003728238.1.41337 WP_003728238.1.41603 WP_003728238.1.4166 WP_003728238.1.41876 WP_003728238.1.42040 WP_003728238.1.42089 WP_003728238.1.42317 WP_003728238.1.42525 WP_003728238.1.42550 WP_003728238.1.42616 WP_003728238.1.42994 WP_003728238.1.43060 WP_003728238.1.43336 WP_003728238.1.43350 WP_003728238.1.43458 WP_003728238.1.43480 WP_003728238.1.43807 WP_003728238.1.43916 WP_003728238.1.44092 WP_003728238.1.44147 WP_003728238.1.44161 WP_003728238.1.44427 WP_003728238.1.44663 WP_003728238.1.4472 WP_003728238.1.44749 WP_003728238.1.44806 WP_003728238.1.45355 WP_003728238.1.45512 WP_003728238.1.4557 WP_003728238.1.45719 WP_003728238.1.45778 WP_003728238.1.4587 WP_003728238.1.45893 WP_003728238.1.46154 WP_003728238.1.46180 WP_003728238.1.4642 WP_003728238.1.46566 WP_003728238.1.46711 WP_003728238.1.46725 WP_003728238.1.46834 WP_003728238.1.46867 WP_003728238.1.46981 WP_003728238.1.47001 WP_003728238.1.47075 WP_003728238.1.47384 WP_003728238.1.47431 WP_003728238.1.47518 WP_003728238.1.47520 WP_003728238.1.47650 WP_003728238.1.47979 WP_003728238.1.48007 WP_003728238.1.48163 WP_003728238.1.48175 WP_003728238.1.48235 WP_003728238.1.48410 WP_003728238.1.48565 WP_003728238.1.48854 WP_003728238.1.49 WP_003728238.1.49390 WP_003728238.1.49391 WP_003728238.1.49458 WP_003728238.1.49708 WP_003728238.1.50044 WP_003728238.1.50063 WP_003728238.1.50288 WP_003728238.1.50293 WP_003728238.1.50482 WP_003728238.1.50662 WP_003728238.1.50765 WP_003728238.1.50775 WP_003728238.1.51086 WP_003728238.1.51262 WP_003728238.1.51384 WP_003728238.1.51493 WP_003728238.1.5170 WP_003728238.1.51768 WP_003728238.1.51980 WP_003728238.1.52142 WP_003728238.1.52290 WP_003728238.1.52507 WP_003728238.1.52725 WP_003728238.1.52782 WP_003728238.1.53051 WP_003728238.1.53566 WP_003728238.1.53603 WP_003728238.1.53870 WP_003728238.1.54281 WP_003728238.1.54434 WP_003728238.1.54506 WP_003728238.1.5472 WP_003728238.1.54740 WP_003728238.1.54750 WP_003728238.1.54884 WP_003728238.1.55027 WP_003728238.1.55068 WP_003728238.1.5538 WP_003728238.1.55386 WP_003728238.1.55510 WP_003728238.1.5631 WP_003728238.1.56322 WP_003728238.1.56344 WP_003728238.1.5671 WP_003728238.1.56748 WP_003728238.1.5687 WP_003728238.1.57374 WP_003728238.1.57536 WP_003728238.1.57932 WP_003728238.1.58 WP_003728238.1.58083 WP_003728238.1.58516 WP_003728238.1.58966 WP_003728238.1.59493 WP_003728238.1.59542 WP_003728238.1.59652 WP_003728238.1.59720 WP_003728238.1.59744 WP_003728238.1.59826 WP_003728238.1.59975 WP_003728238.1.60132 WP_003728238.1.60162 WP_003728238.1.60295 WP_003728238.1.60543 WP_003728238.1.60674 WP_003728238.1.60762 WP_003728238.1.60766 WP_003728238.1.61358 WP_003728238.1.61384 WP_003728238.1.61525 WP_003728238.1.61824 WP_003728238.1.61915 WP_003728238.1.62494 WP_003728238.1.62573 WP_003728238.1.62690 WP_003728238.1.6281 WP_003728238.1.62874 WP_003728238.1.63209 WP_003728238.1.63269 WP_003728238.1.63283 WP_003728238.1.63315 WP_003728238.1.63883 WP_003728238.1.64289 WP_003728238.1.64413 WP_003728238.1.64531 WP_003728238.1.64587 WP_003728238.1.64796 WP_003728238.1.64869 WP_003728238.1.64929 WP_003728238.1.65392 WP_003728238.1.65780 WP_003728238.1.66057 WP_003728238.1.66134 WP_003728238.1.66285 WP_003728238.1.66296 WP_003728238.1.66510 WP_003728238.1.66545 WP_003728238.1.66743 WP_003728238.1.6745 WP_003728238.1.67573 WP_003728238.1.67813 WP_003728238.1.68128 WP_003728238.1.68497 WP_003728238.1.68517 WP_003728238.1.68740 WP_003728238.1.69360 WP_003728238.1.69603 WP_003728238.1.69864 WP_003728238.1.70100 WP_003728238.1.70373 WP_003728238.1.70590 WP_003728238.1.70633 WP_003728238.1.70736 WP_003728238.1.71474 WP_003728238.1.7175 WP_003728238.1.71904 WP_003728238.1.72370 WP_003728238.1.72546 WP_003728238.1.72623 WP_003728238.1.72813 WP_003728238.1.72886 WP_003728238.1.73152 WP_003728238.1.73263 WP_003728238.1.73458 WP_003728238.1.73545 WP_003728238.1.74095 WP_003728238.1.74148 WP_003728238.1.7421 WP_003728238.1.74303 WP_003728238.1.74617 WP_003728238.1.74728 WP_003728238.1.74823 WP_003728238.1.74956 WP_003728238.1.75072 WP_003728238.1.75196 WP_003728238.1.75216 WP_003728238.1.7528 WP_003728238.1.75548 WP_003728238.1.75923 WP_003728238.1.76094 WP_003728238.1.76168 WP_003728238.1.76254 WP_003728238.1.76608 WP_003728238.1.76926 WP_003728238.1.76982 WP_003728238.1.77191 WP_003728238.1.77261 WP_003728238.1.7738 WP_003728238.1.77389 WP_003728238.1.77594 WP_003728238.1.77675 WP_003728238.1.77849 WP_003728238.1.77943 WP_003728238.1.78088 WP_003728238.1.78130 WP_003728238.1.78328 WP_003728238.1.78717 WP_003728238.1.79259 WP_003728238.1.79295 WP_003728238.1.79602 WP_003728238.1.79821 WP_003728238.1.80088 WP_003728238.1.80514 WP_003728238.1.80693 WP_003728238.1.80968 WP_003728238.1.81270 WP_003728238.1.81315 WP_003728238.1.8151 WP_003728238.1.81647 WP_003728238.1.81693 WP_003728238.1.81725 WP_003728238.1.81863 WP_003728238.1.82294 WP_003728238.1.82372 WP_003728238.1.82480 WP_003728238.1.82605 WP_003728238.1.82662 WP_003728238.1.82974 WP_003728238.1.83217 WP_003728238.1.83236 WP_003728238.1.83755 WP_003728238.1.83877 WP_003728238.1.8391 WP_003728238.1.84895 WP_003728238.1.84974 WP_003728238.1.85172 WP_003728238.1.85317 WP_003728238.1.85321 WP_003728238.1.85576 WP_003728238.1.85887 WP_003728238.1.86056 WP_003728238.1.86571 WP_003728238.1.86752 WP_003728238.1.87101 WP_003728238.1.8715 WP_003728238.1.87294 WP_003728238.1.87537 WP_003728238.1.87890 WP_003728238.1.87903 WP_003728238.1.88055 WP_003728238.1.88211 WP_003728238.1.88639 WP_003728238.1.88768 WP_003728238.1.88783 WP_003728238.1.88800 WP_003728238.1.88806 WP_003728238.1.88877 WP_003728238.1.88974 WP_003728238.1.89014 WP_003728238.1.89267 WP_003728238.1.89302 WP_003728238.1.89756 WP_003728238.1.89812 WP_003728238.1.89897 WP_003728238.1.90135 WP_003728238.1.90212 WP_003728238.1.90326 WP_003728238.1.90459 WP_003728238.1.90524 WP_003728238.1.90646 WP_003728238.1.90741 WP_003728238.1.90772 WP_003728238.1.90857 WP_003728238.1.91084 WP_003728238.1.91140 WP_003728238.1.91195 WP_003728238.1.91920 WP_003728238.1.92288 WP_003728238.1.9282 WP_003728238.1.92928 WP_003728238.1.92963 WP_003728238.1.93014 WP_003728238.1.93049 WP_003728238.1.93217 WP_003728238.1.93325 WP_003728238.1.93421 WP_003728238.1.93534 WP_003728238.1.93558 WP_003728238.1.93611 WP_003728238.1.93712 WP_003728238.1.93867 WP_003728238.1.94026 WP_003728238.1.94081 WP_003728238.1.94206 WP_003728238.1.94225 WP_003728238.1.94431 WP_003728238.1.94447 WP_003728238.1.94464 WP_003728238.1.94499 WP_003728238.1.94537 WP_003728238.1.94554 WP_003728238.1.94613 WP_003728238.1.9470 WP_003728238.1.94759 WP_003728238.1.94906 WP_003728238.1.9502 WP_003728238.1.9505 WP_003728238.1.95100 WP_003728238.1.95146 WP_003728238.1.9517 WP_003728238.1.95256 WP_003728238.1.95696 WP_003728238.1.96084 WP_003728238.1.96156 WP_003728238.1.96438 WP_003728238.1.96542 WP_003728238.1.96544 WP_003728238.1.96596 WP_003728238.1.96605 WP_003728238.1.96751 WP_003728238.1.96867 WP_003728238.1.97140 WP_003728238.1.97378 WP_003728238.1.97569 WP_003728238.1.97587 WP_003728238.1.97589 WP_003728238.1.9769 WP_003728238.1.97803 WP_003728238.1.97900 WP_003728238.1.97970 WP_003728238.1.9802 WP_003728238.1.98375 WP_003728238.1.98689 WP_003728238.1.98826 WP_003728238.1.98829 WP_003728238.1.99199 WP_003728238.1.99553 WP_003728238.1.99568 WP_003728238.1.99663 WP_003728238.1.99702 WP_003728238.1.99737 WP_003728238.1.99818 WP_003728238.1.99836 WP_003728238.1.99906 gi|404281348|ref|YP_006682246.1| gi|405755897|ref|YP_006679361.1| gi|405752963|ref|YP_006676428.1| gi|386027112|ref|YP_005947888.1| gi|226224341|ref|YP_002758448.1| gi|217964115|ref|YP_002349793.1| gi|406704520|ref|YP_006754874.1| gi|386732477|ref|YP_006205973.1| gi|386008508|ref|YP_005926786.1| gi|404287166|ref|YP_006693752.1| gi|404408178|ref|YP_006690893.1| gi|424714615|ref|YP_007015330.1| gi|46907968|ref|YP_014357.1| 265669.LMOf2365_1762 552536.LMHCC_0827 634178.Lm4b_01752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]